(data stored in ACNUC7421 zone)

EMBL: CP001069.PE480

CP001069.PE480       Location/Qualifiers
FT   CDS_pept        552935..553225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4259"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS02582 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29356"
FT                   /db_xref="GOA:B2UIF5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIF5"
FT                   /protein_id="ACD29356.1"
FT                   /translation="MWRRIKASWMAIFLVTLLGAGYLWMYRFEPLLSGEAGSDVFVWDR
FT                   WTHRVCALTDNGEATEWRCDNAMETDGSSSNTNSDVSIRKRMRDAVQRIKL"
     atgtggcgcc gaatcaaagc gtcctggatg gcgatctttc tggtcaccct gttgggtgcc        60
     gggtacttgt ggatgtaccg ttttgagccg ctgctctccg gtgaggcggg cagcgatgtg       120
     tttgtgtggg accgctggac gcaccgcgtc tgtgcgctga ccgacaacgg tgaagctacg       180
     gaatggcgtt gcgataacgc catggaaacc gacggctcca gcagcaacac caactcggac       240
     gtctcgatcc ggaagcgcat gcgcgacgcc gtgcaacgca tcaagctgta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page