(data stored in ACNUC7421 zone)

EMBL: CP001069.PE486

CP001069.PE486       Location/Qualifiers
FT   CDS_pept        complement(557537..558679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4265"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: pap:PSPA7_5127 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29362"
FT                   /db_xref="GOA:B2UIG1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG1"
FT                   /protein_id="ACD29362.1"
FT                   /translation="MLRPVLFRLHWLIGLSASVVLAVVGATGALMAYEDELLRALNPGV
FT                   LTLPARSGPAPTLPQVAAQARAAMPDRPVTFITAASDPTQPWRVWYAWPPGKHGGSSRG
FT                   ELRYVDATTGTLLPEARAQRFFATVKLLHRTLLADEIGKQIVGASTVGLVVMALSGLYL
FT                   RWPRRVTNWRSWLVIRWSRAGRIRWWDVHTVIGTLVLPLYLLAAFSGLYWAYDWYRDGL
FT                   QRLAGMPVVSKAKPVEVPRKPLEDAAIERTWNAFRDNASNYGTATLRIDDARSGQVDIN
FT                   WLPADAPHDRAFNRLTLDAATGAVLRNESFAAKPPMQRLLAGMLPLHNGRYFGPIGVVL
FT                   VLIGALMLPVFAATGWWLYLDRRRRAQPQRKHASAATRPC"
     atgctgcgac cggtgctgtt ccgcttgcac tggctgatcg ggttgtcggc cagtgtggtg        60
     ctggccgtcg ttggcgccac cggcgcgctg atggcgtacg aagacgaact gctgcgcgcg       120
     ctcaatcccg gcgtgctcac cctgcccgcg cgcagcggac ccgcgccgac gctgccgcaa       180
     gtggcggcgc aggcgcgcgc tgccatgccg gaccgccccg tcaccttcat caccgctgcg       240
     tccgacccca cccagccgtg gcgcgtctgg tatgcgtggc cgcccggcaa acacggcggc       300
     agcagccgcg gagagctgcg ctacgtcgat gccaccaccg gcacgttgct gccggaggcg       360
     cgcgcgcagc gcttctttgc caccgtcaag ctgctgcatc gaacgctgct tgctgatgag       420
     atcggcaagc agatcgtggg ggccagcacg gtggggctcg tcgtgatggc gctgtcgggc       480
     ttgtacctgc gttggccgcg tcgcgtcacg aactggcgaa gctggcttgt catccgatgg       540
     agccgtgcgg gccgcatccg atggtgggac gtgcacaccg tcatcggtac gctggtgttg       600
     ccgctgtatc tgctggccgc cttcagcggg ctgtattggg catatgactg gtaccgcgat       660
     ggcctgcagc gcttggccgg catgccggtt gtctccaagg caaaaccggt ggaagtcccg       720
     cgaaaaccgc tcgaagatgc ggcaattgag cgcacgtgga acgctttccg cgacaacgcg       780
     tcgaactatg gaacggccac cctccgtatc gacgatgccc gctcgggcca ggtcgatatc       840
     aactggctgc cggccgatgc tccgcacgac cgcgccttca accgattgac gctggacgct       900
     gctaccggcg ccgtcctgcg caacgaatcc ttcgctgcaa agccgccaat gcaacgcctg       960
     ctggcaggca tgttgccgct tcacaatgga cgctatttcg gcccgatcgg cgtcgtgcta      1020
     gtgttgatcg gagcattaat gctgccggta tttgcagcaa cagggtggtg gctgtatctg      1080
     gatcggcgcc gacgcgcgca accgcagcgc aaacacgcat ccgcagcgac acgtccttgc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page