(data stored in SCRATCH zone)

EMBL: CP001069.PE487

CP001069.PE487       Location/Qualifiers
FT   CDS_pept        complement(558710..560830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4266"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: rso:RS02469 probable ferrisiderophore receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29363"
FT                   /db_xref="GOA:B2UIG2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG2"
FT                   /protein_id="ACD29363.1"
FT                   /translation="MPPKRLCLSLAVLGTLPFAQVASAADTVAAADAGTLPTSTVKGAR
FT                   SSTSYDTPIANTATKIPVPLREIPQSVNVVPRAVIQDQGALSINDTLRNVPGVSASLGD
FT                   AQRDQVTIRGFSSINDQYVDGLRDDSLYFRDLSNIDHIEVLKGPAAVLYGRGSSGGIIN
FT                   RVTKKPLATPLAEVGVVVGTERQKRAEFDLNTSINDDAIRARITGAVEDSGGFRNDYFL
FT                   RRQAISPSFLFNLAPDTKLTVQFDYLHDKRIADQGVPSYHGRPVDVPIGTRYGSADAGA
FT                   GNVESTVKSVTGTLDHRFNDKWSFHSVVRNYEYSLGRNNYTTVSRVTDGPIPTVTLAVN
FT                   QRNRSDRGTLWQNELTQKAETWGIQHTLLYGIELGYQDKSDRVAAAPGSTTYNLFNPTL
FT                   QVLPTVPGNAVPTNYGLSHNETYAAYVQDLIKFSPQWTVLAGLRYEILKQSRDDLTPRN
FT                   VDLSRTDKPVSPRFGVVYHPVEPLSLYASYSRSFQPLADSFTFFPNSGALAPQSTTNYE
FT                   IGAKYDLSAGASVTAALFDMKQTNLTAADPVTLLGVPIGTQRTRGLELSFTGEIVKTWS
FT                   LMASYAYLNGRLENPNDRSGGVAVNGNQPSLTPRHSGSVWLKHDLPNGFYVAGGVRAEG
FT                   ARYASQYNLTTLPGYMTVDLGAGYRSKHLDVTLNLQNLFNRAYYVSAHGAAENYNMPGA
FT                   PRMALLGVRYKM"
     atgccgccga aacgtttgtg cctgtctctg gccgtccttg gaacgctgcc ctttgctcaa        60
     gtggcaagtg ccgccgacac cgttgctgca gccgacgctg gcacgttgcc gacttccacg       120
     gtcaagggtg cgcgcagcag cacgagctac gacacgccca tcgccaacac agccacgaag       180
     attcccgtgc cgctgcgcga gattccgcaa tcggtgaacg tcgtgccgcg tgcggtgatc       240
     caggatcagg gcgcgctgtc gatcaatgac acgctgcgca acgtgccggg cgtgtcggcc       300
     tcgctgggcg atgcgcagcg cgatcaggtg accattcgcg gtttctcgtc gatcaatgac       360
     caatacgtcg acggcctgcg cgatgattcg ctctacttcc gcgacctgtc caacatcgac       420
     cacattgaag tgttgaaggg cccggcggcc gtgctgtatg ggcgcggttc gtccggcggc       480
     atcatcaatc gcgtgaccaa gaaaccgctg gccacgccac tggccgaggt gggcgtggtg       540
     gtcggcacgg agcgccagaa acgcgccgag ttcgacctga acacgtccat caacgacgac       600
     gccatccgcg cgcgcattac cggcgcggtt gaagattcgg gtggtttccg caacgactac       660
     ttcctgcgcc gccaggcgat ctcgccgtcg ttcctgttca acctggcgcc cgataccaaa       720
     ctgaccgtgc agttcgatta cctgcacgac aagcgcatcg ctgaccaggg cgtgccgtcg       780
     taccacggcc gccccgtgga tgtgcccatc ggcacgcgct atggctcggc cgatgcgggc       840
     gccggcaatg tggagtccac cgtcaagagc gtgaccggca cgctggacca tcgcttcaac       900
     gacaaatggt cgttccacag cgtggtgcgc aattacgaat actcgctggg ccgcaacaac       960
     tacacgacag tcagccgcgt caccgatggg ccaatcccga ccgtcacgct tgccgtcaac      1020
     cagcgcaacc gcagcgaccg cggcacgctg tggcagaacg agctgacgca gaaggccgag      1080
     acctggggca tccaacacac gctgctgtac ggcatcgagc tgggctacca ggacaagagc      1140
     gaccgtgtgg ccgccgcgcc gggcagcacg acctacaacc tgttcaaccc gacgctgcaa      1200
     gtgttgccga ccgtacccgg caacgcggtg ccgaccaact acggcctctc gcacaacgag      1260
     acgtatgcgg cgtacgtgca ggacttgatc aagttttcgc cgcaatggac ggtgctcgcc      1320
     ggcctgcgct acgaaatcct caagcagagc cgcgacgacc tgaccccgcg caatgtcgat      1380
     ctgtcacgca cggacaagcc ggtcagcccg cgcttcggcg ttgtgtatca cccggtcgag      1440
     ccgctctcac tgtacgcgtc gtacagccgc tcgttccagc cgctggccga tagcttcacg      1500
     ttcttcccga acagcggcgc actggctccg caatcgacca cgaactacga gatcggcgcc      1560
     aagtacgacc tctcggccgg cgcgagtgtc acggccgcgc tgttcgacat gaagcagacc      1620
     aacctgacgg cggcggatcc ggtcacgctg ctgggcgtgc ccatcggcac ccagcgcacg      1680
     cgcggcctgg agttgtcgtt cactggcgag atcgtgaaaa cctggtcgct gatggcgagc      1740
     tatgcctatc tgaacggtcg cctggaaaac ccgaacgacc gcagcggtgg cgtggcggtc      1800
     aacggcaacc agccgtcgct gacgccgcgg cacagcggct cggtatggct gaagcacgac      1860
     ctgccgaacg gcttctacgt ggccggcggc gtgcgtgcgg aaggtgcgcg ttacgcatcg      1920
     cagtacaacc tgacgacgct gcccggctac atgaccgtcg acctgggtgc cggttatcgc      1980
     agcaagcacc ttgatgtcac gctgaacctg cagaacctgt tcaaccgcgc gtactacgtg      2040
     tcggctcacg gcgccgccga gaactacaac atgcccggtg ccccgcgcat ggcgctgctg      2100
     ggcgtgcgct acaagatgta a                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page