(data stored in ACNUC7421 zone)

EMBL: CP001069.PE488

CP001069.PE488       Location/Qualifiers
FT   CDS_pept        561096..562172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4267"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   oxidoreductase domain protein; Oxidoreductase domain; KEGG:
FT                   rso:RS02398 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29364"
FT                   /db_xref="GOA:B2UIG3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG3"
FT                   /protein_id="ACD29364.1"
FT                   /translation="MPLSAALVGYGYAGKRFHAALIDATPGLRLQVIGSNRPEAVRADR
FT                   PNAVICTPEAAATHADVDLVVIAAPNDRHAPLAEAALRAGKHVVVDKPFTVTLAEARHL
FT                   ARVARDAGRVLSVFQNRRWDSDFLAVQAAIGGGTLGEVMHVEAHFDRYRPQVRARWREQ
FT                   AGQGTGIWFDLGPHLIDQALQLLGLPDAVSASFARQRPGAETPDWAHVVLDVGERRAVL
FT                   HASMLVAGGSPRWIVHGTRGSFVKRRMDQQEAQLLAGMQPGAQGWGVDDDAGLFIDGAT
FT                   SSENRIATPAGDQRAYYAAVRDAIFGQRTNPVPPVQAVAVMAVLEAAVAAAETGTAVVP
FT                   DLTDAERADWLAARETAS"
     atgccattga gcgccgcttt ggtcggctac ggttatgccg gcaagcgctt tcacgccgcg        60
     ttgatcgacg ccacgccagg gctgcgtttg caggtcatcg gctccaatcg accggaggcg       120
     gtgcgcgcgg atcggccaaa cgcggtgatc tgcacgccag aagcggcggc aacgcatgcg       180
     gacgtcgacc tcgtcgtcat tgccgcaccc aacgaccgcc atgcgccgtt ggcagaagcg       240
     gcgttgcgag cgggcaagca tgtcgtcgtg gacaagccgt tcaccgtcac gctcgcagaa       300
     gcgcggcatc tggcgcgggt ggcgcgcgac gcggggcgcg tgctgtcggt gtttcagaac       360
     cggcgctggg acagcgattt cctcgccgtg caagccgcga tcggaggcgg cacccttggc       420
     gaagtcatgc acgtcgaggc gcatttcgac cggtatcgac cgcaggtgcg tgcgcgctgg       480
     cgcgagcaag cggggcaggg cacgggcatc tggtttgatc tgggcccgca cctgatcgac       540
     caggcgctgc aactgcttgg gctgcccgat gcggtgagcg cctcgtttgc acgccagcgg       600
     ccgggcgccg aaacgccgga ctgggcgcat gtcgtgttgg acgtggggga gcgccgagcc       660
     gtccttcacg cgagcatgct ggtggcgggc ggatccccgc gctggatcgt ccacggcacg       720
     cgcggttcgt tcgtcaaacg ccggatggat cagcaggaag cgcaactgct cgccggcatg       780
     caacccggcg cgcaaggctg gggcgtggac gatgacgccg gccttttcat cgatggcgca       840
     acatcctccg aaaaccgcat cgcaacgccc gctggcgatc agcgcgccta ctacgccgct       900
     gtgcgcgacg ccatctttgg tcagcgcaca aaccctgtgc cgcccgtgca agccgtggcc       960
     gtcatggccg tgctcgaagc cgccgtggct gccgccgaaa ccggcacggc agtcgtgccg      1020
     gacctgaccg atgccgaacg tgcagattgg ctggctgcgc gggagaccgc ctcgtga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page