(data stored in ACNUC7421 zone)

EMBL: CP001069.PE491

CP001069.PE491       Location/Qualifiers
FT   CDS_pept        complement(565602..566387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4270"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: rso:RS02396 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29367"
FT                   /db_xref="GOA:B2UIG6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIG6"
FT                   /protein_id="ACD29367.1"
FT                   /translation="MSDLKGKVAVVTGAASGIGKQIALTLANSGAAIAIVDLNEDGAKA
FT                   VAKEITDAGGKAIGLRMDVTDEQAVDSGIDRVAEELGSVDILVSNAGIQIVNPFVSYSF
FT                   ADWKKMQAIHVDGAFLTTRAALRHMYKDDRGGVVIYMGSVHSHEGSPLKSAYVAAKHAL
FT                   LGLNKVLAKEGAAHNVRSHVVCPGFVRTPLVEKQIPEQAKELGISEDDVVKKVMLGDTV
FT                   DGVFTTVEDVAETVRFLATFPSAALTGQSFVVSHGWFMQ"
     atgtctgatt tgaaaggcaa agtcgccgtc gtcacgggtg ccgccagcgg catcggcaag        60
     cagatcgccc tcacgctcgc caattcgggc gcggccattg ccatcgttga cttgaacgaa       120
     gacggcgcca aggccgtcgc caaagagatc accgatgcag gcggcaaggc gatcggcctg       180
     cgcatggacg tgaccgatga acaagccgtg gacagcggca tcgaccgcgt ggccgaagaa       240
     ctcggctcgg tcgacatcct ggtctcgaat gccggcatcc agatcgtcaa cccgttcgtg       300
     agctactcgt ttgccgactg gaagaagatg caggccatcc acgtcgacgg cgcgttcctg       360
     accacgcgcg ccgcactgcg ccacatgtac aaggacgacc gtggcggcgt ggtgatctac       420
     atgggctcgg tgcactcgca cgagggctcg ccgctcaaat cggcctacgt ggcggccaag       480
     catgcactgc tcggcctgaa caaggtactg gccaaggaag gcgcggcgca taacgtgcgc       540
     tcgcacgtgg tgtgccccgg cttcgtgcgc acgccgctgg tcgaaaagca gattcccgaa       600
     caagccaagg aactcggcat cagcgaagat gacgtggtga aaaaggtcat gctgggtgat       660
     accgtggacg gcgtattcac cacggtggaa gacgtggccg agacggtgcg cttcctggcc       720
     acgttcccaa gtgccgcgct gaccggccaa tcgttcgtgg tgagccacgg ctggttcatg       780
     caataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page