(data stored in ACNUC7421 zone)

EMBL: CP001069.PE495

CP001069.PE495       Location/Qualifiers
FT   CDS_pept        570275..571798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4274"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: rso:RS02392 probable
FT                   transmembrane aldehyde dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29371"
FT                   /db_xref="GOA:B2UIH0"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH0"
FT                   /protein_id="ACD29371.1"
FT                   /translation="MNRPIDPAVTESVVSHYIGGQRHAGSGTRSADVFNPATGAVSAQV
FT                   LLGGKSEVDAAVAAAHAAAPDWAETSPLKRSRVLFKFKELLDQNHDALAAAITREHGKV
FT                   FSDAKGEVTRGIEVVEFACGIPNLLKTEFTDNIGGGIDNWNLRQPLGVVAGITPFNFPF
FT                   MVPMWMAPVALACGNTFILKPSERDPTPSLMIADLLKQAGLPDGVFNVVQGGKDAVDAL
FT                   LEHPDVQAISFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHLVVMPDADLDQAVDALIG
FT                   AGYGSAGERCMAISVAVAVGDVADKLVPRLAERARALKIGNGMQADSEMGPLVTAAHKA
FT                   KVEGYIAKGVEEGAELVVDGRGHTVDGHAEGFFTGGTLFDHVKPGMTIYKEEIFGPVLS
FT                   VVRVHDLAEAVDLINAHEFGNGVSCYTSDGGVARAFARQIQVGMVGINVPIPVPMAWHS
FT                   FGGWKRSLFGDHHAYGEEGVRFYTRYKSVMQRWPDSIAKGAEFVMPTAK"
     atgaaccgac cgattgatcc cgccgtgacc gaatccgttg tcagccatta catcggcggg        60
     cagcgccatg ccggcagcgg cacacgcagc gccgatgtct tcaaccccgc tacgggcgcg       120
     gtgagcgcgc aggtgctgct gggcggcaaa tccgaagtgg acgccgccgt agccgccgcg       180
     catgcggctg ccccggactg ggccgagact tcgccgctca agcgctcgcg cgttttgttc       240
     aagttcaagg agctgctcga ccagaaccac gatgctctgg ccgccgccat tacgcgtgag       300
     cacggcaagg tgttctccga tgccaaaggc gaagtgacgc gcggcattga agtcgtcgaa       360
     ttcgcctgcg gcattccgaa cctgctcaag acggagttca cggacaacat cggcggcggc       420
     atcgacaact ggaacctgcg ccagccgctg ggcgtggtgg ccggcattac gccgttcaac       480
     ttcccgttca tggtgccgat gtggatggcg ccggttgcgc tggcgtgcgg caatacgttc       540
     atcctcaagc ccagcgaacg tgacccgacc cccagcctga tgattgccga cctgctcaag       600
     caggcgggcc ttcccgatgg tgtgttcaac gtggtacagg gtggcaagga tgccgttgat       660
     gcgctgctcg agcatccgga tgtgcaggcc atttcgttcg tcggcagcac gcccatcgcc       720
     gaatacatct acgccgaagg caccaagcgc ggcaagcgcg tgcaagccct gggcggcgca       780
     aagaatcacc tcgtcgtcat gccggatgca gacctcgacc aagcggtgga tgccttgatc       840
     ggtgcaggct acggttcggc cggtgagcgc tgcatggcga tctccgtggc tgtggcagtg       900
     ggcgacgtgg ctgacaagct cgtcccgcgc cttgccgagc gcgcccgcgc gctcaagatc       960
     ggcaacggca tgcaggccga cagcgaaatg ggtccacttg tgaccgccgc ccacaaggcc      1020
     aaggtggaag gctatatcgc caagggcgtg gaagagggcg ccgagctggt cgtggacggc      1080
     cgcggccaca cggtcgacgg ccatgccgaa ggcttcttca cgggcggcac gctgttcgac      1140
     cacgtcaagc ccgggatgac gatctacaag gaagagatct tcggccccgt gctttcggtg      1200
     gtgcgcgtgc atgaccttgc cgaggcggtg gatctgatca atgcgcatga gttcggcaac      1260
     ggcgtgtcgt gctacacgag cgatggcggc gtggcgcgcg catttgcgcg gcagatccag      1320
     gtgggcatgg tcggtatcaa tgtgccgatt ccggtgccga tggcgtggca tagcttcggc      1380
     ggctggaagc gctcgctgtt cggcgaccac cacgcctatg gcgaagaagg cgtgcgtttc      1440
     tacacgcgtt acaagagcgt gatgcaacgc tggccggatt cgattgccaa gggcgccgag      1500
     ttcgtgatgc cgacagccaa gtaa                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page