(data stored in ACNUC7421 zone)

EMBL: CP001069.PE496

CP001069.PE496       Location/Qualifiers
FT   CDS_pept        complement(571875..572081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4275"
FT                   /product="putative cold-shock DNA-binding domain protein"
FT                   /note="KEGG: rso:RS02391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29372"
FT                   /db_xref="GOA:B2UIH1"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH1"
FT                   /protein_id="ACD29372.1"
FT                   /translation="MASRIEENAVEYDPPAGAAAEMHAAPSFIRDSEIQFSRSQTFHEG
FT                   QRVSFDVEIGPDGELIAVNIKPI"
     atggccagcc gaattgaaga gaacgccgtt gaatatgatc cgcccgccgg ggcagctgca        60
     gaaatgcatg ctgccccgag tttcattcgg gattcggaaa tccagttttc gcgctcgcag       120
     acattccacg agggccagcg cgtcagcttc gatgtagaaa tcgggcccga tggcgaactc       180
     atcgccgtca acatcaaacc aatatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page