(data stored in SCRATCH zone)

EMBL: CP001069.PE499

CP001069.PE499       Location/Qualifiers
FT   CDS_pept        complement(574728..575543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4278"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: rso:RSp1050 probable formate dehydrogenase associated
FT                   protein (FdhD protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29375"
FT                   /db_xref="GOA:B2UIH4"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH4"
FT                   /protein_id="ACD29375.1"
FT                   /translation="MTFLPHHPAGLPVVSTAATKRTRAGTQEDTPAAIADEAAVALVFN
FT                   GITHAVMMASPTDLEDFALGFALSEGIIDSRADWRGADVETHPHGLEVHAEIASHCFVR
FT                   LKERRRALAGPTGCGLCGIESLQTFEDAPQPLVPPAWLASLADAQVLDAMQAMTAHQPA
FT                   NALTGGLHAAGWVPADTHAPLHVLEDVGRHNALDKLIGRLARLGIRPSDGFIVMTSRAS
FT                   FELARKCVQLQVPLLATISAPSSLAIRHAKAGQLTLLAFCRGDSVTRFA"
     atgacttttc tgccccacca ccccgccggc ttgcccgtcg tttccaccgc cgcgacgaaa        60
     cgcacgcgcg ctggcacgca agaggacacc cccgccgcca ttgccgatga agctgcggtg       120
     gcgcttgtct tcaacggcat cacgcatgcg gtgatgatgg cgtcgccgac tgacctggaa       180
     gacttcgcgc tgggctttgc gctgtcggaa ggcatcatcg acagtcgcgc cgattggcgt       240
     ggcgcagacg tggaaacgca tccgcatggg ctcgaagtac acgcagaaat tgcttcgcat       300
     tgcttcgtgc ggttgaagga acgccgtcgg gcgctggccg gcccgaccgg ctgtgggctg       360
     tgcggcattg aaagcctgca gacttttgaa gacgcgccgc aaccgcttgt gccacccgcg       420
     tggttggcat cacttgccga cgcgcaggta ttggatgcca tgcaggcgat gacggcgcat       480
     cagccggcca acgcgctcac gggcggcttg catgcggcgg gctgggtgcc cgcagacacc       540
     catgcaccac tgcatgttct ggaagatgtg ggccgccaca acgctctcga caagctgatc       600
     ggccggctgg ctcggctcgg catccgcccc tcggatgggt tcatcgtcat gacgagtcgt       660
     gcgagcttcg agctggcgcg caagtgcgtt caactgcagg tgccgctgct ggcaacgatc       720
     tccgcgccgt cctcactcgc gatccgccac gccaaggccg gccagctgac gctgcttgcg       780
     ttctgccgag gcgatagcgt gacgcggttt gcgtaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page