(data stored in ACNUC7421 zone)

EMBL: CP001069.PE5

CP001069.PE5         Location/Qualifiers
FT   CDS_pept        complement(3721..4026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3765"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3765"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH30"
FT                   /protein_id="ACD28881.1"
FT                   /translation="MELSETNPFPKSDGHGNLIRDDVAQAAERVKATTAQAIDRTADAA
FT                   ATALDEAAVKREQWRASQQRLMSDAAECMRTHPLATIGLAFGAGFLLSRLLGGRDD"
     atggaactct ctgagaccaa cccgttcccg aaatccgacg gccacggcaa cctgatccgc        60
     gatgacgtgg cgcaagccgc cgagcgcgtc aaggcgacga ctgcccaggc catcgaccgc       120
     accgctgatg ccgccgccac ggcgctcgac gaggccgccg tcaagcgcga gcagtggcgt       180
     gcgtcgcagc agcggctcat gtcggatgcg gccgagtgca tgcgtacaca cccgctcgcc       240
     acgatcggcc tcgcgtttgg cgccggcttt ttgctgagcc gactgctggg cgggcgcgac       300
     gattga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page