(data stored in ACNUC7421 zone)

EMBL: CP001069.PE500

CP001069.PE500       Location/Qualifiers
FT   CDS_pept        complement(575540..575785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29376"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH5"
FT                   /protein_id="ACD29376.1"
FT                   /translation="MPTEPAWSALQLALLAALRETDAGKPVSMPWLTKRVGERASTVLR
FT                   ALHPLADAGLLRVTMDDTRWLIALLDAGRVLPDFTA"
     atgcccaccg agccggcgtg gtctgcgctg cagctggcgc tgctggccgc attgcgcgag        60
     accgacgccg gcaagccggt gtcgatgccg tggctgacca agcgcgtggg cgagcgcgcc       120
     agcacggtcc tgcgcgcgct gcatccgctg gccgatgcag gcctgctgcg cgtcaccatg       180
     gacgacacac gctggctcat tgcgctgctc gacgccggcc gcgttctgcc tgacttcact       240
     gcatga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page