(data stored in SCRATCH zone)

EMBL: CP001069.PE502

CP001069.PE502       Location/Qualifiers
FT   CDS_pept        complement(578153..579880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4281"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS02384 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29378"
FT                   /db_xref="GOA:B2UIH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIH7"
FT                   /protein_id="ACD29378.1"
FT                   /translation="MTGAAAPFHHVRHNTGSTYPGVDSMSEAVLHPFFSRERTVAAVGF
FT                   NRWLVPPAALAIHLCIGMAYGFSVFWLPLGRALGITKPLTCGADVSLVAELFTTTCDWR
FT                   VSSLGWMFTLFFVFLGASAAMWGGWLERVGPRKAGVVSAVCWCGGLLISALGIQIHQLW
FT                   LLWVGSGVIGGVGLGLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMIGAPLADRLM
FT                   KLFATPESVGVSQTFIVLAGIYFVFMMAGALGYRVPPTGWKPAGWTPSPAKAKDTMVTQ
FT                   RHVHANEALKTPQFWLIWAVLCLNVSAGIGVLGMASPLLQEVFGGKLLGVTTSFMDLTA
FT                   AQKGQIAAIAAGFTGLLSLFNIGGRFFWASLSDRLGRKMTYAVFFVLGFVLYASIPWTS
FT                   HTGNIALFALAFCVILSMYGGGFATVPAYLADMFGTQMVGAIHGRLLTAWSTAGILGPV
FT                   LVNYLREYQIAHGVERAAVYDITMMILAGLLILGFICNLLVRPVNAKHFMTEAQLDEQR
FT                   HAAATKSPTPSVASPETSLEWQAHPGSAVAVVLAWAAVGLPLGWGVWITLQKAAVLFS"
     atgaccggcg cggccgcacc gtttcaccac gtacgtcaca acacgggctc aacttatccg        60
     ggggtggatt cgatgtccga agcagtcctg catccatttt tttcgcgcga gcgcaccgtc       120
     gccgcggttg gcttcaaccg ctggctggtt ccgcctgccg cactggccat ccatctgtgc       180
     attggcatgg cctacggttt ttccgtcttc tggctgccgc tcggccgcgc gctgggcatc       240
     accaagccgc tcacatgcgg cgccgatgtc tcgctggtcg ccgagctgtt caccaccacc       300
     tgcgactggc gcgtctccag cctgggctgg atgttcacgc tgttcttcgt gttcctgggc       360
     gcatccgctg ccatgtgggg cggttggctc gaacgcgttg gcccgcgcaa ggctggcgtc       420
     gtgtcggctg tgtgctggtg cggcgggctg ctaatttccg cactgggcat ccagattcac       480
     caactgtggc tgctgtgggt gggctcgggc gtgatcggcg gcgtcggcct ggggctgggc       540
     tacatctcgc ccgtgtcgac gctcatcaag tggtttccgg acaagcgtgg catggccacg       600
     ggcatggcca tcatgggttt tggcggcggc gcgatgatcg gcgccccgct ggctgaccgc       660
     ctgatgaagc tgtttgcgac gcccgaatct gtgggcgtgt cgcaaacctt tattgtgctg       720
     gccggcatct acttcgtgtt catgatggca ggtgcgctgg gttaccgtgt gccgcccacg       780
     ggctggaaac cggcaggctg gacaccctcc ccggccaagg cgaaggacac gatggtcacg       840
     caacgccatg tccacgcaaa cgaagcgctg aagacgccgc agttctggct gatctgggcc       900
     gtgctgtgcc tgaacgtatc ggccggtatt ggcgtgctgg gcatggcctc gccactgctg       960
     caggaagtgt ttggcggcaa gctgctgggc gtgacgacgt cgttcatgga cctgaccgcc      1020
     gcgcaaaagg gccagatcgc agccatcgct gcgggcttca cgggtctgct gagcctgttc      1080
     aacatcggcg gccgtttctt ctgggcgtcg ctctcggacc gcctgggccg caagatgacc      1140
     tacgcggtct tcttcgtgct cggcttcgtg ctgtatgcgt cgattccgtg gacgtcgcac      1200
     acgggcaata tcgcgctgtt cgcactggcc ttctgcgtga tcctgtcgat gtacggcggc      1260
     ggttttgcga ccgtgccggc gtatctggct gacatgttcg gcacgcaaat ggtgggcgcc      1320
     atccacggcc ggctgctcac ggcgtggtcg acggccggca tcctgggccc cgtgctggtg      1380
     aactacctgc gcgaatacca gatcgcccat ggcgtggaac gcgcagccgt gtacgacatc      1440
     acgatgatga tcctggccgg cctgctgatc ctcggcttca tctgcaacct gctagtgcgc      1500
     cctgtcaacg cgaagcactt catgaccgaa gcgcagctcg acgagcaacg acatgctgcg      1560
     gcaaccaaga gcccaacgcc gtcggttgct tcgccggaga cgtcgctgga atggcaggcg      1620
     catccgggct cggcggtagc cgtggtgctg gcctgggccg ccgtgggcct gccgttgggc      1680
     tggggggttt ggattacact ccaaaaagct gccgttctct tctcctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page