(data stored in SCRATCH zone)

EMBL: CP001069.PE505

CP001069.PE505       Location/Qualifiers
FT   CDS_pept        complement(583759..584907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4284"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: pnu:Pnuc_1301 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29381"
FT                   /db_xref="GOA:B2UII0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII0"
FT                   /protein_id="ACD29381.1"
FT                   /translation="MKKFSPVVAVIALAAALAVGVVVGRKWPAAVPAETAKPEAGPASA
FT                   PAAASRPKPDSIEIPSGGFDPQQVKVAQASQLSVPVELSTPGKLAYNAERTKLASARVA
FT                   GRLDHILQFEGALVREGQPIAELYAPDYISAQKEYLLALNTARQLKGSNMKDLQEDADA
FT                   TVQSAAGRLHVLGMSDADVAQIAKRGTPAEHLTLRAPISGTIVKRNMDPGAFLNVGDSF
FT                   MSIVDTRVLWFTGNVYENDIASVRIGQPISLHTSAYPDREFTGRVSFIAPNIDPATHTL
FT                   TVRCDVPNNDGLLRPEMYATARIQTGTGQATVVPKSALVKDHGSYFVIVQSDATHFKRV
FT                   EVHGKDIGTDGNFAVTAGLEASSQVVVRGAALLNEMIVKAGA"
     atgaagaagt tctctcctgt cgttgctgtg atcgccctgg cagcggccct cgctgtgggc        60
     gtggtggtcg gacgcaagtg gcctgccgcc gtgccggccg agactgcaaa acccgaagcg       120
     ggcccggcat ctgcgccggc tgccgcgtcg cgtccgaaac cggactccat tgaaattcct       180
     tctggcggct tcgaccccca gcaggtgaag gtcgcgcagg ccagccagct ttcggtgccg       240
     gtggaattgt ccacacccgg caagctggcc tacaacgcgg agcgcaccaa gctggcgtcc       300
     gcacgcgtgg ccggccggct tgatcacatc ctccagttcg aaggggcgct ggtgcgtgag       360
     ggccagccga ttgccgagct gtacgcgccg gactacatct ctgcgcagaa ggaatacctg       420
     ctggcgctga ataccgcccg ccagctcaag ggctccaaca tgaaggactt gcaggaagac       480
     gcagacgcca ccgtgcagtc cgccgcaggt cgcctgcacg tgctgggcat gtccgatgcc       540
     gatgtcgcgc aaatagccaa gcgcggcaca ccggctgaac acctgacgct gcgcgcgccc       600
     atctcgggca cgatcgtcaa gcgcaacatg gacccgggcg ccttcctcaa cgtgggcgac       660
     tcgttcatga gcatcgtcga tacgcgtgtg ctgtggttta cgggcaatgt gtatgagaac       720
     gacattgcca gcgtgcgcat cggtcagccg atctcgctgc acacgtcggc gtatccggac       780
     cgcgagttca cgggccgcgt gagcttcatc gccccaaaca tcgacccggc cacgcacacg       840
     ttgacggtgc gctgcgacgt gccgaacaac gacggcctgc tgcgccccga gatgtacgcc       900
     acggcgcgca tccagaccgg caccggccag gccacggtgg tgccgaagtc cgccctggtg       960
     aaagaccatg gcagctactt cgtgatcgtg cagagcgatg ctacgcactt caagcgcgtc      1020
     gaagtgcacg gcaaggacat cggcaccgac ggcaactttg ccgtgacggc agggcttgag      1080
     gcttcgtcgc aggtggtggt gcgcggtgcc gcgctgctta acgagatgat cgtcaaggca      1140
     ggagcgtag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page