(data stored in ACNUC7421 zone)

EMBL: CP001069.PE508

CP001069.PE508       Location/Qualifiers
FT   CDS_pept        586943..587365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29384"
FT                   /db_xref="GOA:B2UII3"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII3"
FT                   /protein_id="ACD29384.1"
FT                   /translation="MVSESTFLRIVRASAWYDLIVTAPFATPWTFALLHQALSALAHAL
FT                   GIGSLPPFEPTHLLMANLMGSVVCVWSVLRIRQTSVVLGRYDAVARGLFAAWQAYALAS
FT                   GATLLVVPFLIAEIGFGLLQSLPVGRVPGRAGARAA"
     atggtttccg aatcgacctt cctgcgcatt gtgcgagcca gcgcctggta tgacctgatc        60
     gtgaccgcac cctttgccac gccatggacg ttcgcgctgt tgcatcaggc gctgagcgca       120
     ttggcgcacg cgctgggcat cggcagcttg ccgccatttg agccgacgca tctgctgatg       180
     gccaacctga tgggatcggt ggtgtgcgtg tggtcggtgc tgcgtatccg acagacgagt       240
     gtggtgctcg gccggtacga cgccgtggcg cgcggcctgt ttgcggcgtg gcaggcatac       300
     gcgctggcat cgggcgctac gctgctggtg gtgcccttcc tgatcgcaga gattggcttc       360
     gggctgctgc aatcgctgcc cgtgggccgc gtgcccgggc gagcaggcgc gcgggcagcg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page