(data stored in ACNUC7421 zone)

EMBL: CP001069.PE51

CP001069.PE51        Location/Qualifiers
FT   CDS_pept        59300..61927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3811"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: pfo:Pfl_3044 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3811"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28927"
FT                   /db_xref="GOA:B2UH76"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH76"
FT                   /protein_id="ACD28927.1"
FT                   /translation="MTAPRFTKLEASIAMSTCQTTQAFSRKTNGKAVAARPSATPLYLA
FT                   VCLAMMNTARAAEGETLVAQVDPTLLAYNTSFLQGQGRPADLSAVLSSGSSVPPGTYRV
FT                   EVQVNGNLVGRRDIDFYQDSDKAKLRPCLTAKMLQDFGVSLSSITPPLDINSHACLDLP
FT                   HVLDQASADFDAGRLQLNLSIPQAFLSRAARGYVDPALWDEGVTAGYVNYQFSGNYGHS
FT                   GTGNDSSSYFIGLQNGVNIGRWRLRNESTVSGSNSGQTRFKSNRTLVQRDVDAIKGQLT
FT                   LGEQYSDATLFDSVRFRGVQIGSDDAMLPDSERGYAPVVRGQAATNAVVEVRQSGYVLY
FT                   RANVPPGPFQLTDIFPSGSNGDLEITVIEADGTRRVTHQAFSSLPLMLRKGRLKYNFAA
FT                   GKYDGDQGPSPNLLSGSLVYGLTDNSTVAGGLQVSKDFQAVNVGVGTNTPIGALSVDLT
FT                   QSSSRVRGERDTGQSVRILYAKTFTSTNTNFTLAAYRYSTSGYRTFNDHVNDLSNNAGN
FT                   AWFNATGFQAGRSRSRIDLTTSQDLGGIERQYGSVYLNVSQQTFWNQPGSSRSISLGYG
FT                   NNWKQLSYNLSLSQTNDTRFSGSGNSTQVMLTMSIPLGSKLHSPRAYTNISNTNNGGTT
FT                   VQSGLSGFVNDNTSYAMQAGYTGSGRGATGGASLTRDTDMGQLNANVNVARDYQSASVG
FT                   ATGSVVVHRGGVNLGRTVGDTFALMKVEGIKGVDMKTDAGVSVGRNGYAVITYAQPYRL
FT                   NALSPDTHNLGADVELEDTVKQVVPRRGAIVQATFKGYSGQRAQFAFQQPDGKPVPFGA
FT                   SVEEAPTGRHLGITDPNGNAFVLLRQEQGTLTVKWKDNQCQAPYALGQAEPGRNYRKQT
FT                   LRCR"
     gtgacagccc cccgattcac caagctagaa gcgagcattg cgatgtctac ctgccagacg        60
     acccaagcgt tctccagaaa gaccaatgga aaagcggttg ctgcgcgtcc gagcgcaacg       120
     ccgctgtatc tggccgtatg tctggcaatg atgaacaccg cgcgcgctgc cgagggggag       180
     acgctcgtcg cgcaggtgga tccgacgctg cttgcgtaca acacgagttt cctgcaaggt       240
     caagggcgtc cggctgatct gagcgctgtg ctcagttctg gcagcagcgt gccgccaggt       300
     acgtatcggg tcgaggtgca ggtcaacggt aatctggtcg gccgccgcga catcgacttc       360
     tatcaggaca gcgacaaagc caagctgcgc ccgtgcctga cggccaagat gctgcaggac       420
     tttggcgtca gcctgagctc cattacgccg ccgctggaca tcaacagcca cgcctgcctg       480
     gatttgccgc acgtgctgga ccaggcttcc gccgatttcg atgcgggccg gctgcagctc       540
     aacctcagca ttccgcaggc gttcctgtcc cgtgctgcgc gcgggtatgt cgaccctgcg       600
     ttgtgggacg agggtgtcac cgccggctac gtcaactacc agttcagcgg caactacggc       660
     cacagcggca ccggcaacga cagcagcagc tacttcatcg gcttgcagaa cggcgtgaat       720
     attggtcgtt ggcggttgcg aaacgagtcc acggtcagcg gcagcaacag cggccagacc       780
     cgcttcaaga gcaaccgcac gctcgtgcag cgcgacgtcg atgccatcaa gggccagctg       840
     acccttggcg aacagtattc cgacgccacg ctgttcgaca gcgtgcgctt tcgcggtgtg       900
     caaatcggct ccgacgacgc gatgctgccc gacagcgagc gcggctacgc tccagtcgtg       960
     cgtggccagg cggccaccaa cgcagtggtt gaggtgcgcc agagcggtta tgtgctctat      1020
     cgggccaacg tgccgccagg tccgttccag ctgactgaca ttttcccctc cggctccaac      1080
     ggcgatctcg agatcaccgt gatcgaagcc gacggcaccc ggcgcgtcac gcatcaggcg      1140
     ttctccagcc tgccgctgat gctgcgcaag ggccgcctga agtacaactt tgcggcgggc      1200
     aagtacgacg gcgaccaagg tccgtcgccc aatctgctca gcggctcgct cgtctacggt      1260
     ctgaccgaca acagcacggt agctggcggc ctgcaggtct cgaaggattt ccaggcggtg      1320
     aacgtgggcg ttggtaccaa cacgcccatc ggcgcgctct ccgttgacct gacccaatcc      1380
     agcagccgtg tgcgcggcga gcgggatacc gggcagagtg tgcggatcct gtacgccaag      1440
     acgtttacga gcaccaacac caacttcacg cttgctgcct atcgctattc gacgtcgggt      1500
     tatcgcacct tcaacgacca cgtcaacgac ctgagcaaca acgcaggcaa cgcgtggttc      1560
     aacgccacgg gcttccaggc gggtcgtagc cgctcacgca ttgacctgac gaccagccag      1620
     gacctcggtg gcatagagcg ccaatacggc agtgtctacc tgaacgtcag ccagcagact      1680
     ttctggaacc agccgggctc gagccgcagc atcagtctcg gctacggcaa caactggaag      1740
     cagctgagtt acaacctcag tctgagccag acgaacgaca cgcgcttcag cgggagcggc      1800
     aacagcacgc aagtcatgct gacaatgtcg attccgcttg gcagcaagct gcactcgccg      1860
     cgcgcctata ccaacatcag caataccaac aacggcggca ccactgtcca gagcgggctg      1920
     agcggcttcg tcaacgacaa cacgtcgtat gccatgcagg ccggttacac cggcagtgga      1980
     cgcggcgcta ccggcggggc aagcctcacg cgcgataccg atatgggcca gctcaacgcc      2040
     aacgtgaacg ttgcgcgcga ctatcaatcg gccagcgtgg gcgccacggg ctcggtggta      2100
     gtccatcgtg ggggcgttaa cctgggccgc accgtcggcg ataccttcgc cttgatgaag      2160
     gtggaaggaa tcaagggcgt ggacatgaag accgatgctg gcgtctcggt cggccgcaac      2220
     ggctatgcgg tgatcaccta tgcgcagccc tatcgactga atgcgctgag ccccgacacc      2280
     cacaaccttg gcgcggacgt agaactggaa gacaccgtca agcaggtggt gccgcgccgc      2340
     ggcgcaatcg tccaggcgac tttcaagggc tacagcggac agcgcgccca gtttgcgttc      2400
     cagcagcccg atggcaagcc ggtgccattc ggcgccagcg tggaagaagc gccaacgggc      2460
     agacacctcg gcattacgga tccgaacggc aacgcgttcg tgctgctccg gcaggagcag      2520
     ggcaccttga cggtgaagtg gaaagacaac cagtgtcagg cgccgtatgc gttgggtcag      2580
     gctgaacccg gacggaacta ccggaagcag acgctgcgct gtcgttga                   2628
//

If you have problems or comments...

PBIL Back to PBIL home page