(data stored in ACNUC7421 zone)

EMBL: CP001069.PE510

CP001069.PE510       Location/Qualifiers
FT   CDS_pept        complement(587857..588327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4289"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rso:RS02374
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29386"
FT                   /db_xref="GOA:B2UII5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII5"
FT                   /protein_id="ACD29386.1"
FT                   /translation="MNTLTTTFAPLTRIRASLERLAGPQSMLCSIILLIARAYLFYVFF
FT                   RSGLTKLHDWDTTVLLFTEEYKVPLLPPALAAALGTFGELVFPSLMLAGIVPRLAAAGL
FT                   FFVNVVAAVSYWANLSASAIEFHLVWGVLIALVATVGPGWLAAQNLWQRRKH"
     atgaataccc tcaccacaac ctttgcccca ctcacgcgta tccgcgcatc gctggaacgg        60
     cttgccggcc cgcagagcat gctctgttcg atcatcctgt tgatcgcgcg cgcgtatctc       120
     ttctacgtgt tcttccgctc gggcctgacc aaactgcacg actgggacac gaccgtgctc       180
     ctcttcaccg aggaatacaa ggtgccgctg ctgccgcccg cactggcagc ggcgcttggc       240
     acctttggcg aactggtctt cccctctctg atgctggccg gcatcgtgcc ccggctggcg       300
     gcggcggggc tgttctttgt caacgtggtg gcagcggtgt cgtactgggc caatctgtcg       360
     gcatcggcca tcgagtttca cttggtttgg ggcgtgctga ttgcgctcgt ggcgacggtg       420
     ggacccggct ggctggcggc gcagaacctt tggcagcgcc gtaagcacta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page