(data stored in ACNUC7421 zone)

EMBL: CP001069.PE512

CP001069.PE512       Location/Qualifiers
FT   CDS_pept        complement(589069..589935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4291"
FT                   /product="protein of unknown function DUF692"
FT                   /note="PFAM: protein of unknown function DUF692; KEGG:
FT                   rso:RS02372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29388"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII7"
FT                   /protein_id="ACD29388.1"
FT                   /translation="MQTALPTCAGAGLRAPHFPALLHGEARFPWAEVHSENYLYGGPAR
FT                   AALLAARAHQPVSLHGVGMGLGNADGLDVEHVRAIAMLADAVAPAAISEHLCFNRSGAQ
FT                   VVNDLLPLPYSRESLDIVCANVMRAQDILKQPLLIENIAAYIDCRTLVDADEAISEGAF
FT                   LTALARRTGCGILLDLNNLYVNSVNHGVTVESVLTDIDPALVGEIHLAGFSVEDGMLID
FT                   THSAPVHAPVWALYNAWVAKHGARPTLIEWDAELPPVQVLLDEAARAQAVLNRHTNAMQ
FT                   ETRHATA"
     atgcagaccg ctctgccaac ctgcgccggc gcaggcctgc gcgcgccgca ctttcctgcc        60
     ctgctgcacg gggaagcccg cttcccgtgg gcagaagtgc acagcgagaa ctatctgtat       120
     ggcggccccg cacgtgcagc gctgctggcc gcgcgagcgc accagccggt gagcctgcac       180
     ggcgtgggca tggggcttgg caatgcggat ggactggatg tcgaacacgt acgcgccatc       240
     gccatgcttg ccgatgccgt agcgccggcc gccatttccg agcacctgtg cttcaaccgc       300
     agcggcgcgc aggtcgtcaa cgatcttttg ccgctgccct attcccgcga atcgctcgat       360
     atcgtctgcg ccaacgtcat gcgggcacag gacattctca agcagccgct gctgatcgag       420
     aacattgccg cgtacatcga ctgccgcacg ctggtcgatg ccgacgaggc catctccgaa       480
     ggcgcattcc tgaccgccct cgcccgacgc acgggctgcg gcatcctgct ggacctaaac       540
     aatctgtacg tgaacagcgt caaccatggc gtgacagtcg aatccgtact caccgatatc       600
     gacccagcgc tggtcggcga aattcacctg gcgggcttca gcgtggaaga cggcatgctg       660
     atcgacacgc atagcgcgcc ggtccatgcg cccgtctggg cgttgtacaa cgcgtgggtt       720
     gccaagcacg gcgcacgccc gacactgatc gaatgggacg ctgaactgcc gcccgtgcag       780
     gtgttgctgg acgaggcggc acgtgcccag gcggtactga atcgccacac caacgccatg       840
     caggagacac gccatgcgac tgcctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page