(data stored in ACNUC7421 zone)

EMBL: CP001069.PE514

CP001069.PE514       Location/Qualifiers
FT   CDS_pept        complement(590452..590976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UII9"
FT                   /protein_id="ACD29390.1"
FT                   /translation="MPERKTVERARADKRHGKAASTQAGNFVKEEMDHIREGKHGAKNT
FT                   KQAIAIGLSKARRSGVAIKPPGEGKASAATRKKAEHDVKAGSKKSSHASASASKESTAK
FT                   RSKTTTRTLQKEGHSAASKSSLSKQAHSAASKRSSSERSAAAKKGAATKGAAGRSAAAK
FT                   KAGRTRAAHAR"
     atgccggaac gcaaaaccgt agaacgtgcg cgcgccgaca agcgccacgg caaggccgcc        60
     tcaacgcagg caggcaactt cgtgaaggaa gagatggatc acatccgcga aggcaagcac       120
     ggtgcgaaaa acaccaagca ggctatcgcg attggactat ccaaggcacg ccgctctggc       180
     gttgccatca agccgccggg ggaaggcaag gcgtcggctg ccacgcgcaa gaaggcggaa       240
     catgacgtga aggcgggcag caagaagagc agccacgcca gcgccagcgc cagcaaggaa       300
     tccaccgcaa agcgcagcaa aaccaccaca cgcacgctgc aaaaggaagg ccattcggcg       360
     gcatccaagt cgtcgctatc caagcaggcc catagcgcgg cctccaagcg ttcgagcagt       420
     gaacgctcgg cggcggccaa gaaaggcgcc gccaccaagg gcgcggcggg acgctccgct       480
     gccgcaaaga aggcgggacg cacgcgcgct gcgcacgcca ggtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page