(data stored in ACNUC7421 zone)

EMBL: CP001069.PE515

CP001069.PE515       Location/Qualifiers
FT   CDS_pept        complement(591097..591366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29391"
FT                   /db_xref="GOA:B2UIJ0"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ0"
FT                   /protein_id="ACD29391.1"
FT                   /translation="MKEGHPPEPGRETAIAWILEQMQTYDLSVDDLQAHGCFDAPPPPP
FT                   APPASIGPVYMSADGQHWDGSGDMPDWLQRAVNAGQSIEHFRVG"
     atgaaggaag gtcacccgcc ggagccgggt cgcgaaaccg cgatcgcctg gatcctggaa        60
     caaatgcaaa cctacgatct gtctgtcgac gatttgcagg cgcatggctg ctttgacgcg       120
     ccaccgccgc cgcccgcacc acctgcgtcc atcggcccgg tctacatgag cgccgacggc       180
     cagcactggg acggctcggg cgacatgccc gactggctgc aacgcgccgt caatgccgga       240
     cagagcatcg aacatttccg cgtgggctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page