(data stored in ACNUC7421 zone)

EMBL: CP001069.PE516

CP001069.PE516       Location/Qualifiers
FT   CDS_pept        complement(591525..592466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4295"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mlo:mlr3911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29392"
FT                   /db_xref="GOA:B2UIJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ1"
FT                   /protein_id="ACD29392.1"
FT                   /translation="MRSFLHPMLKVVRMNDKTRGTVEMTTAMVISGTIGWFVVRSGQPV
FT                   ADVVFWRCVFGALTLLAVCAGLGLLRGAITWRRAAIATLGGVAIVINWLLLFAAYPRAS
FT                   ISIATAVYNTQPFMLVGLGAMFLSEKLTAAKLTWLAIAFIGVVLIVQVGPAASVGTDYL
FT                   AGIAMALGAAFAYAVAALLIKKLAGTPPHLIALIQVCVGVLMLAPLANLSHPPADAHTW
FT                   VMLVTVGVVHTGLMYILLYGAIQRLPTHLTGSLSFVYPIVAIVVDIVAFGHRLQLAQFL
FT                   GAGGILLAAAGMNLGWSPYRWLRARAESPVSK"
     atgcgatcct ttttgcatcc aatgctcaag gtggttcgca tgaacgataa gacgcgcggc        60
     acggtcgaga tgaccaccgc catggtcatc tccgggacga tcggctggtt cgtcgtccgc       120
     tcaggccagc cggtggccga cgttgtgttc tggcgctgcg tgttcggcgc gctgacgctg       180
     cttgcggtat gcgccggact gggcctgctg cgcggcgcga tcacgtggcg gcgcgccgcg       240
     attgccacgc tgggcggcgt ggccatcgtc atcaattggc tgctgctgtt tgcagcgtat       300
     ccgcgcgcgt ccatctcgat tgccacggcg gtctacaaca cgcagccatt catgctggtc       360
     gggctgggcg cgatgtttct gtcggaaaag ctgacggccg ccaagctcac gtggctggcc       420
     atcgccttta tcggcgtcgt actgatcgtg caggtggggc ctgccgccag cgtcggtacc       480
     gattacctcg cgggcattgc gatggcgctg ggcgcggcgt ttgcgtatgc ggtggccgcg       540
     ctcctgatca agaaactggc cggtacgccg ccgcatctga tcgcgctcat ccaggtgtgc       600
     gtgggcgtgc tgatgttggc gccgctggcc aacctgtcgc atccgcccgc cgatgcgcat       660
     acgtgggtga tgcttgtcac ggtgggcgtg gtgcatacgg ggttgatgta catcctcctc       720
     tatggcgcca tccagcggct gccgacgcat ctgacggggt cgttgtcatt cgtctatccg       780
     attgttgcca tcgtggtgga cattgttgcg ttcgggcatc ggctgcaact cgcgcagttt       840
     ttgggcgcgg gggggatcct gctggcggcg gcgggcatga acctggggtg gtcgccgtat       900
     cggtggttgc gggcgcgggc cgaatccccc gtttccaaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page