(data stored in ACNUC7421 zone)

EMBL: CP001069.PE519

CP001069.PE519       Location/Qualifiers
FT   CDS_pept        594934..596664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4299"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: rso:RSp0274 probable
FT                   gamma-glutamyltranspeptidase signal peptide protein;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29395"
FT                   /db_xref="GOA:B2UIJ4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ4"
FT                   /protein_id="ACD29395.1"
FT                   /translation="MQNPRTGMRWIAAAIASISITTVTHAASVAPVAAENGMVVAAQHL
FT                   ASKVGVEVLKRGGNAVDAAVAVGYALAVVYPAAGNLGGGGFMTIQLADGRKTFLDFREV
FT                   APKAATANMYLDKDGNVIKGASTKGHLAVGVPGTVSGMEYARQKYGTMQRAALIAPAIT
FT                   LAEKGFVLDQGDVDMLHTSTKDFQEDAASGAIFLNKGQPFQVGEKLVQHDLAKTLREIS
FT                   THGTDGFYKGWVGQAIAASSKAGGGLITQDDLVSYKTRELAPVECDYRGYHVVSAPPPS
FT                   SGGVIICEMLNILEGYPLKDLGWHSAQATHYQIEAMRHAYVDRNSYLGDPDFVKNPLDR
FT                   LLSKDYAAKIRAVIDPKKAGVSKDIKPGVEPHEGSNTTHYSIADKYGNAVSVTYTLNDW
FT                   FGAKVTAAKTGVILNDEMDDFTAKVGVPNLYGLVQGEANSIAPGKRPLSSMSPTIVTKD
FT                   GKPVMVVGTPGGSRIITAVMLTMINAIDYGMNVQEAVDMPRFHQQWLPDVTNVEPYALS
FT                   EDTRKILTSMGHNLGAPQPANHLAAIIVGAPSLGGKPVGNNRFYGANDPRRNTGLAAGY
FT                   "
     atgcagaatc caagaacagg catgcggtgg atcgccgccg caatcgcatc gatcagcatc        60
     acgaccgtca cacacgcggc atccgtcgca cccgtggccg cagagaacgg catggtcgtc       120
     gcggcacagc acctggccag caaggtcggc gtggaagtgc tcaagcgcgg cggcaatgct       180
     gtcgacgcgg cagtggctgt gggctacgcg ctggccgtgg tctatccggc agccggcaac       240
     ctgggcggcg gtggtttcat gaccatccag ctggccgatg gtcgcaagac cttcctcgac       300
     ttccgtgaag tcgccccgaa ggccgccacc gccaacatgt acctggacaa ggacggcaac       360
     gtcatcaagg gcgcgtccac caagggtcat ctggccgtgg gcgtgccggg caccgtgtcc       420
     ggcatggaat acgcccgcca gaagtacggc accatgcaac gcgctgcact gatcgcaccg       480
     gccatcacgc tggccgaaaa gggcttcgtc ctcgatcagg gcgatgtcga catgctgcac       540
     acctccacca aggacttcca ggaagacgcc gcatcgggcg cgatcttcct gaacaagggg       600
     cagcccttcc aggtgggcga gaagctggtg cagcatgatc tggccaagac gctgcgtgag       660
     atcagcacac atggcaccga cggcttctac aagggctggg tcgggcaggc cattgctgca       720
     tcgagcaagg ccggcggtgg cctgatcacg caagatgatc tcgtcagcta caagacgcgc       780
     gagctggcgc cggtcgagtg cgactaccgt ggttatcacg tggtgtcggc accgcccccg       840
     agctcgggcg gcgtgatcat ctgcgaaatg ctgaacatcc tggaaggcta tccgctgaaa       900
     gatctgggct ggcattccgc gcaggctacg cactaccaga tcgaagccat gcgccacgcc       960
     tacgtggatc gcaacagcta cctgggcgat cccgatttcg tgaagaaccc gctggaccgt      1020
     ctgctgagca aggactacgc ggccaagatc cgtgccgtga tcgacccgaa gaaggcgggc      1080
     gtgtcgaagg acatcaagcc gggcgtcgag ccgcatgaag gcagcaacac gacgcactac      1140
     tcgattgccg acaagtacgg caacgcggtg tcggtcacgt acacgctcaa cgactggttt      1200
     ggtgcgaagg tcacggcggc caagacgggc gtgatcctga acgacgagat ggacgacttc      1260
     accgccaagg tcggcgtgcc gaacctgtac ggtctggtgc agggcgaggc caactcgatc      1320
     gccccgggca agcgtccgct gtcgtcgatg agcccgacga tcgtcaccaa ggacggcaag      1380
     cctgtcatgg tggtgggcac gccgggcggc agccgcatca tcacggccgt catgctgacc      1440
     atgatcaacg cgatcgacta cggcatgaac gtgcaggaag ccgtcgacat gccgcgcttc      1500
     caccagcaat ggctgccgga tgtgaccaac gtcgagccgt atgcgctgtc ggaagatacg      1560
     cgcaagatcc tgacatcgat gggccacaac cttggcgcgc cgcagccggc caaccacctg      1620
     gcggcgatca tcgtcggggc gccgtcgctg ggcggcaagc cggttggcaa caaccgcttc      1680
     tatggcgcga atgatccgcg tcgcaacacg gggctggcag ccggttattg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page