(data stored in SCRATCH zone)

EMBL: CP001069.PE52

CP001069.PE52        Location/Qualifiers
FT   CDS_pept        63686..63982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3814"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rme:Rmet_6073 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3814"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28928"
FT                   /db_xref="GOA:B2UH77"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH77"
FT                   /protein_id="ACD28928.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
     atgacaagca agacaaagcg ggcgcagtac acgctggaat tcaagctgga agcggtacgg        60
     ctggtgaaga gcgggcagag catggcagtg gttagcgcga ccctgggcat cagagcgcag       120
     acgctgcata actgggtcaa ggcggagcgg gaaggcaagc tgactggtgc gggtatgaag       180
     ccggtcagcc cggagcagat ggagctggcc cggcttcggg cggaggtggc gcgcttgaag       240
     atggagcgcg atattttaaa aaaagccgca gcatactttg cgaaggagtc ggtgtga          297
//

If you have problems or comments...

PBIL Back to PBIL home page