(data stored in ACNUC7421 zone)

EMBL: CP001069.PE523

CP001069.PE523       Location/Qualifiers
FT   CDS_pept        complement(599944..601329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: dac:Daci_4438 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29399"
FT                   /db_xref="GOA:B2UIJ8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ8"
FT                   /protein_id="ACD29399.1"
FT                   /translation="MTAAPAHEPLGKHQSKKAAASGWIGSALEYYDFFIYATAAALIFP
FT                   QIFFPKGDPKTAIIASLATYGVGYIARPIGAFVLGHLGDTHGRKNVLLWCMFLMGFSTI
FT                   AVGLLPTYDQVGLWAPTLLVIMRLIQGFAVAGEISGASSMILEHAPFGRRGFFASFTLQ
FT                   GVQAGQILAAAVFLPLAHYMPADQFNSWGWRIPFLLSFVVIIAGYVIRREVHETPAFTA
FT                   EQQQQGRPRSPVIDAFKYSTPDMLRVVCMALMNVIPVVATIFGAAYAVQPAYGIGFAKD
FT                   IYLWIPVVGNIVAVLVIPYVGDLSDRIGRKPPIVLGSLLAGVLAFAYLYAISIKNVPLA
FT                   FGMSILMWGVVYQGYNAVFPSFYPELFPTRTRVSAMAISQNIGTAITAMLPALFTAVAP
FT                   PGATNIWLTVGAIAFGVTVIAAVAAMTARETYRIHMDDLGQPAAQPVDKAEYARQRAGA
FT                   LAA"
     atgaccgcag cccctgccca cgagcccttg ggcaagcacc agtcgaagaa agccgccgcc        60
     agcggctgga tcggctcggc gctcgagtac tacgacttct ttatctacgc caccgcagcg       120
     gcgctgatct ttccgcaaat cttcttcccc aagggcgacc ccaagacggc catcatcgcc       180
     tcgctggcca cgtacggcgt gggttacatc gcgcggccga tcggggcgtt cgtgctgggc       240
     catctgggcg acacgcacgg gcgcaagaac gtgctgctct ggtgcatgtt cctgatgggt       300
     ttttcgacca ttgccgtggg cttgctgccc acgtacgacc aggttgggct gtgggctccc       360
     acgttgctgg tcatcatgcg gctgatccag gggtttgccg tggccgggga aatttcgggc       420
     gccagttcga tgatcctgga gcacgcacca tttggccggc gcgggttttt tgcgagcttt       480
     acgctgcaag gggtgcaggc gggccagatc ctggcggctg ccgtgttctt gccgctggcg       540
     cactacatgc cggccgacca gttcaacagc tggggctggc gcattccgtt cctgctgagt       600
     ttcgtggtca tcatcgcggg ctacgtcatc cgccgcgaag tgcacgaaac accggcgttt       660
     accgctgagc aacagcaaca aggccgcccg cgctcgcccg tgatcgacgc tttcaaatac       720
     agcacgcccg acatgttgcg cgtggtctgc atggcgctga tgaacgtgat tccggtggtg       780
     gcgactatct ttggggccgc ctacgcggtg cagccggctt acggcatcgg ctttgccaaa       840
     gacatctacc tgtggattcc ggtggtgggc aacatcgttg ccgtgctggt cattccgtat       900
     gttggcgacc tgtccgaccg catcggccgc aagccaccga tcgtgctggg ctcgctgctc       960
     gccggcgtgc ttgcgtttgc gtatctgtat gccatcagca tcaagaacgt gccgctggcc      1020
     tttggcatgt cgatcctgat gtggggcgtg gtctatcagg gctacaacgc ggtgttcccg      1080
     agcttctatc cggagctgtt cccgacgcgc acccgtgtat cggctatggc gatttcgcag      1140
     aacatcggca ccgcaattac tgccatgctg ccggccctct tcaccgccgt ggcaccgccg      1200
     ggagccacca acatctggct gaccgtgggc gccattgcct ttggcgtaac ggtgattgcc      1260
     gccgtggccg ccatgaccgc tcgtgagacg taccgcatcc acatggacga cctgggtcag      1320
     ccagccgccc aacccgtcga caaggcagaa tatgcccgcc agcgggccgg agccctcgct      1380
     gcctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page