(data stored in ACNUC7421 zone)

EMBL: CP001069.PE524

CP001069.PE524       Location/Qualifiers
FT   CDS_pept        complement(601561..602328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4304"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: reu:Reut_B5034 regulatory protein,
FT                   IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29400"
FT                   /db_xref="GOA:B2UIJ9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIJ9"
FT                   /protein_id="ACD29400.1"
FT                   /translation="MTKEPLNRRDWIAGLEKGLAILEAFDHEHPRLTPTQAAELTGLTR
FT                   TAARRYLLTLEHLGYLTSEGTLFSLTPRVLKVGWSYFDSARLPRTVQPFLQQVTAAVGE
FT                   VAYLSVLDDWELVFISRTSTSRVMSTGFVLGARVPAPLASAGVMMLAAQPEQKVKAWLE
FT                   TCVLTPYTPYTILQRDRLFDEIRKAGRQDYAVVEQQLQIGVRGVAVPLRDRHGNVIAAL
FT                   SVNMQVGEETTEHALQRVLQVLQDTALSIMRVL"
     atgacgaagg aaccgctgaa ccggcgcgac tggattgccg ggctggaaaa agggctcgcg        60
     atcctggagg cattcgacca cgagcacccg cggttgacgc ccacccaggc cgccgagttg       120
     accggcctta cccgcacagc cgcgcgccgt tacctgctga cgcttgaaca cctgggctac       180
     ctcaccagcg aaggcacgct gttcagtctg acgccgcgtg tgctgaaggt cggctggtcg       240
     tacttcgatt cggcgcgcct gccgcgcacg gtgcagccgt tcctgcagca ggtgaccgcc       300
     gccgtgggcg aggtggcata cctcagcgtg ctggatgatt gggagctcgt tttcatttcg       360
     cgcaccagca ccagtcgggt catgagcacg ggattcgtcc tgggtgcacg cgtgcccgcc       420
     ccgctcgcgt cggccggtgt gatgatgctg gccgcgcaac ccgagcagaa ggtcaaggca       480
     tggctggaaa cctgtgtgct gacgccgtac acgccttaca cgatcctgca gcgggaccgc       540
     ctgttcgatg aaatccgcaa ggccggcagg caggactacg ccgtggtcga acagcagttg       600
     cagattggcg tgcggggcgt ggccgtgccg ttgcgtgacc ggcacggcaa cgtgatcgcc       660
     gcgctgagcg tgaacatgca ggtcggtgaa gaaaccaccg agcacgcctt gcagcgggta       720
     ctgcaggtgc tgcaggacac cgccctttcg atcatgcgcg tgctgtag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page