(data stored in ACNUC7421 zone)

EMBL: CP001069.PE527

CP001069.PE527       Location/Qualifiers
FT   CDS_pept        complement(605599..606852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4307"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   reu:Reut_B3726 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29403"
FT                   /db_xref="GOA:B2UIK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK2"
FT                   /protein_id="ACD29403.1"
FT                   /translation="MTHIVIVGAGISGVTTAYTLSQLGYQVTVLDRHLYPAMETSFANG
FT                   GQLSASNAEVWNSTGTLLKGIKWMLRNDAPLLLNPKPSWHKYSWIGEFVASIAHYRRNT
FT                   IETTRMAIEARKHLFAMAEREQIDFDLQKRGILHVYHDKASFAAAGKANALLVAGGLER
FT                   HAVSPEEIAAIEPTLRGNYYGGYFTESDATGDIHKFTRGLAQACERRGVRFMQGVDVRD
FT                   VQTTEGGVSLLLQTTLDDRLSTSAANIVQDLAADAMVVCAGVGSRHIAQLVGDRINVYP
FT                   VKGYSITVHLDDEASVQGAPWVSLLDESAKIVTSRLGTGRFRVAGTAEFNGYNRDIRAD
FT                   RIEPLVAWTRRNFAIGTSRVVPWAGLRPMMPDMMPRVGRGRHARVFYNTGHGHLGWTLS
FT                   GATAAMVGDVIARDCPVH"
     atgacgcaca tcgtcatcgt cggcgccggc atatccggcg tcaccactgc ttacacgctc        60
     tcgcaactcg gttatcaggt cacggtactc gaccgccacc tgtatccggc catggaaaca       120
     tcgttcgcca acggcgggca gctttccgcc agcaacgctg aagtctggaa cagcactggc       180
     acgctgctca agggcatcaa atggatgctg cgcaacgatg ccccgctgct gctcaatccc       240
     aagccctcgt ggcacaaata ctcgtggatc ggcgagttcg tggccagcat cgcgcactac       300
     cgccgcaaca ccatcgaaac cacacgcatg gccatcgagg cacgcaagca tctgtttgcg       360
     atggcggaac gcgagcagat cgatttcgac ctgcagaagc gcggcattct gcacgtctat       420
     cacgacaagg ccagctttgc ggcagcaggc aaggccaacg ccctgctcgt cgccggcggc       480
     cttgagcgcc acgccgtgag ccccgaggag attgccgcca ttgagccgac gctacgcggc       540
     aactactacg gcggctactt caccgaatcc gacgccaccg gtgacatcca caagttcacg       600
     cggggccttg cgcaggcctg cgaaaggcgc ggcgtgcgct tcatgcaagg cgtggatgtg       660
     cgcgatgtgc aaaccactga aggcggcgtc agcctcctgc tgcagaccac gctggatgac       720
     cgcctttcca ccagtgcggc gaatatcgtt caggaccttg ccgccgatgc gatggtcgtc       780
     tgcgcgggcg tgggcagccg gcatatcgcg caactggtgg gcgatcgcat caacgtgtat       840
     ccggtcaagg gttattcgat cacggtgcac ctggacgatg aagccagcgt gcaaggcgcg       900
     ccgtgggtca gcctgctgga tgagagcgcg aagatcgtga caagccgctt gggcactggc       960
     cggttccgcg tggccggcac ggcggagttc aatggctaca accgcgacat ccgcgccgac      1020
     cgcatcgaac ccctggtggc ctggacgcgc cgcaactttg cgattggcac gtcgcgcgtg      1080
     gtgccctggg ccggcttgcg cccgatgatg ccggacatga tgccgcgcgt cggccgtggc      1140
     aggcacgcgc gcgtgttcta caacacaggc cacgggcacc tcggctggac gctgtccggc      1200
     gccactgccg cgatggtggg cgacgtgatc gcgcgagatt gcccggtgca ttga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page