(data stored in SCRATCH zone)

EMBL: CP001069.PE533

CP001069.PE533       Location/Qualifiers
FT   CDS_pept        612968..614716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4313"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   eba:ebA5073 putative poly-beta-hydroxyalkanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29409"
FT                   /db_xref="GOA:B2UIK8"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIK8"
FT                   /protein_id="ACD29409.1"
FT                   /translation="MRTAPVPSSPTAEQIDLPFHAALARASNSLSIASMQLALFDWALH
FT                   LAGSPGKRLDLWRLALTQAQQLEGYIRNCMASGPQNACLCVQPPARDRRFAADEWRLWP
FT                   FNVLHQSFLLTEQWWEAATRGVWGVAKHHEDVVAFAARQWLDMMSPGNQLATNPIVLRR
FT                   TFEQHGTNLVRGALNALDDLERSMSGAPAAGTERFMVGRDVAITPGKVVLRNRLIELIQ
FT                   YAPATGKVQAEPILIVPAWIMKYYILDLSPQNSLIRYLVEQGHTVFCISWKNPDEADRA
FT                   LDMDDYLKLGVFAALDAVNAIVPGQRVHAAGYCLGGTLLAIAAAAMARDGDARLASMTL
FT                   FAAQTDFCEPGELGLFIDEAQVSLLEAQMEQTGYLRASQMAGAFQMLRSYDLLWSRLVG
FT                   EYLLGDRAPMNDLMAWNADATRMPARMHSQYLRHLFLNDDLSEGHYPVNGKPVALNEID
FT                   LPIFVVGTLTDHVAPWRSVYKLHHLTEAELTFVLTSGGHNAGIVSPPTNSHRRFQMQTR
FT                   HTGETSAGPDDWLASAPATDGSWWPAWHAWLVAHASGSALVKPPKMGVPGLPPLADAPG
FT                   TYVLEK"
     atgcgcaccg cccccgtgcc gtcttcgccg actgcagagc agatcgacct accatttcac        60
     gcggcgcttg cccgcgcgtc caattcgctt tcgattgcat caatgcaact ggccctgttc       120
     gattgggcgc tgcatctggc cggctcaccg ggcaagcggc tggatctgtg gcgattggcg       180
     ctaacgcagg cccaacaact cgagggttac atccggaact gcatggcgtc cggccctcag       240
     aacgcgtgtc tttgcgtcca gccgccggcc cgcgaccgtc gtttcgcggc cgacgagtgg       300
     cgcctgtggc cgttcaacgt gctgcaccag tccttcctat tgacagaaca atggtgggag       360
     gccgccacgc gcggcgtgtg gggtgtcgcc aagcaccatg aggacgtggt cgcctttgct       420
     gcgcgtcaat ggctcgacat gatgtcgccg ggcaaccaat tggcaaccaa ccccattgtc       480
     ctgcgccgga cctttgagca gcacggcacc aaccttgtgc gcggcgcgct caatgcgctt       540
     gacgatctgg agcgctccat gagcggcgcg ccggctgccg gtaccgaacg ctttatggtg       600
     ggccgcgatg tggccatcac gcccggcaag gtggtcttgc gcaaccgcct gatcgagttg       660
     atccagtacg caccggctac gggcaaggtc caggccgagc ccatcctgat cgtgccggcc       720
     tggatcatga agtactacat cctggatctg tcgccgcaga actcgctgat ccgctatctg       780
     gtcgagcagg gccataccgt gttctgcatc tcctggaaga accccgacga ggcggatcgc       840
     gccctcgaca tggatgacta cctcaagctc ggcgtctttg ccgcgctcga tgccgtcaat       900
     gccatcgtgc cgggccagcg cgtccacgcc gccggctact gcctgggggg cacgttattg       960
     gccatcgctg cggctgccat ggcacgcgat ggcgatgcac ggctggcgtc catgacgctc      1020
     tttgccgcgc agactgactt ttgcgagccg ggcgaactgg gcctgttcat cgacgaggca      1080
     caggtcagcc tgcttgaagc gcagatggag cagaccggct atctgcgcgc cagccagatg      1140
     gccggggctt tccagatgct gcgctcatac gacttgctgt ggtcgcgcct ggtgggcgaa      1200
     tacttgctgg gcgaccgcgc acccatgaac gatctgatgg cctggaacgc cgatgccacg      1260
     cgcatgcccg cgcgcatgca cagccagtac ctgcggcatc ttttcctgaa cgacgacctg      1320
     agcgagggcc actatcccgt caacggcaag ccggtggcac tcaacgagat cgatttgccc      1380
     atcttcgtgg tgggcacgct gaccgaccac gtggcgccct ggcgctccgt ctacaagctg      1440
     catcacctga ccgaggcgga gctgacgttc gtgttgacca gcggcggtca taacgccggc      1500
     atcgtcagcc cgcccaccaa ctcgcatcga aggttccaga tgcagacacg ccacacaggc      1560
     gagacatcgg cggggccgga tgactggctg gcatcggcgc ccgccaccga cggttcgtgg      1620
     tggccggcgt ggcacgcatg gctcgttgca catgcatcgg gctccgcgct ggtcaaaccg      1680
     ccgaagatgg gcgttccagg attgccgcca ctggccgacg cgcccggcac ctacgtgctg      1740
     gagaaatag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page