(data stored in SCRATCH zone)

EMBL: CP001069.PE551

CP001069.PE551       Location/Qualifiers
FT   CDS_pept        638892..639158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_5824 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29427"
FT                   /db_xref="GOA:B2UIM6"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIM6"
FT                   /protein_id="ACD29427.1"
FT                   /translation="MNTNTTTKSRGRGKRILVLGGALLLAAVVVGGVMYGPEFYGLLQF
FT                   GKQLDQITQEDTRVGGPWPRVSEVCVSCHGYEGSCQDKANSLS"
     atgaacacga ataccacaac gaaatcacgc ggccgcggca agcggattct ggtactggga        60
     ggcgcgctgc tgttggccgc agtggtggtc ggcggcgtca tgtacgggcc ggagttctat       120
     ggcctgctgc agtttggcaa gcagctcgat cagatcacgc aggaggacac gcgtgtcggc       180
     ggtccatggc cacgcgttag cgaagtgtgc gtgtcttgcc atggttatga ggggtcatgc       240
     caagataagg ccaattcgct atcataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page