(data stored in ACNUC7421 zone)

EMBL: CP001069.PE552

CP001069.PE552       Location/Qualifiers
FT   CDS_pept        639276..642275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4333"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   bvi:Bcep1808_7171 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29428"
FT                   /db_xref="GOA:B2UE95"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE95"
FT                   /protein_id="ACD29428.1"
FT                   /translation="MATVERTAYPRFPKVFSTKELQACYTPTAEELDWATRSTRGQSPR
FT                   LGLLVLLKIFQQLHYFPYLDAIPTAVVDHVRVCAGLDPDTPFGYDRKVSPTLFRHYVVV
FT                   RQFLGVQPYIGTDANEVTIRAAREAAETMDQPVDIINATIDALILQQVELPAFSTLDTI
FT                   VEQIHARTQNAMFRRVARRLSEEDRQRLDKLLTREFANRQTAYNNIKRHARRPSRKHLN
FT                   LLIEHLEWLDSFGDLSGVLEGVPATKLRSLANQAMGLDAANLKETLPEKRYTLIVALLA
FT                   HMRVRSRDDLAEMFIRRMGAIHKRAQDELEYIQSRQRAKLEGLVTVLDGVVDIVADGGD
FT                   DARIGAQVRKLLAPNGDLEPLRERCAEVRAFSGNNYLPLLWRHFRAHRSVMLRLARVLE
FT                   WESTSQSRTLLAGLEVALENESLHREWIAAEVDLSFASERWRKLVRRAHHEGPPTNRRY
FT                   LELCVLSHMVNELRSGDLCVVGSDAFADYRGHLLPWRECERRLPEYCAKLDLPANAQEF
FT                   VAHLKQWLADAAQTLDKSFPDKRQHVTISADGEPLLKRTAARETPPSAVALQQALIRRM
FT                   PTRNLLDVLANIEHWTQFTRHFGPLSGNDPKIRNAAERYLLTIFAMGCNLGPTQAARHM
FT                   GDRVTPHMMSFVNRRHMSLEKLETAQRELIELYLRLDLPKHWGDGKTVAADGTQYDFYD
FT                   NNLLAGYHFRYHKMGAVAYRHVADNYIAVFRHFIPPGVWEAIYVIEGLLKANLSVEADT
FT                   VHADTQGQSAAVFAFTHLLGINLMPRIRNWKELDLYKPDAGVKYKHIDSLFSAVVDWDL
FT                   IAFHWQDLMQVALSIQAGTISSPLLLRRLGSESRKNRLYLAARELGNVVRTVYLLEWVG
FT                   SRELRQEVTATTNKIESYNGFAKWFSFGGDVIAENEPEEQQKRLRYNDLIASAVILQNT
FT                   ADLMQALRTMVSEGIKVNVADIEFLSPYLTHNIKRFGDYKLHLERVPEAWIRDGLFAGP
FT                   ARAVRRARHA"
     atggccaccg tcgagcgcac tgcctacccg cgtttcccaa aggtcttctc cacgaaagag        60
     ctgcaggcct gctacacgcc gaccgctgag gagttggact gggcaacccg ctcgacccgc       120
     ggccagagtc cgcgcctagg tctcttggtg ctgctcaaga tcttccagca actgcactat       180
     ttcccctatc ttgatgcgat tcccaccgcc gtagtcgatc acgtgcgagt ttgcgcgggg       240
     ttggaccccg atacgccgtt cggttacgac cgcaaagtct ctcccacgct gttccggcat       300
     tacgtcgtcg tgcggcaatt cctcggcgtg caaccctaca ttggcaccga cgccaatgag       360
     gtcaccatcc gcgctgcacg tgaagcggcc gagacgatgg atcagccggt ggacattatc       420
     aacgcgacta ttgatgcgct gatcttgcag caggttgaac tgcctgcgtt ctcaacgctc       480
     gacaccatcg tcgagcaaat ccatgcccgc acccaaaacg caatgttcag gcgggtcgca       540
     cgccggctct ctgaagagga tcggcagcgc ctggacaagc ttctcacgcg cgaattcgcc       600
     aaccggcaga ccgcctacaa caacatcaag cgacatgccc ggcggccctc gcgcaaacac       660
     ctgaacctgc tgatcgagca tctggagtgg ttggattctt ttggcgacct atccggcgtc       720
     ctggaaggcg tgcctgccac caagctacgt tcgctggcca accaggccat gggcctggac       780
     gcagccaacc tcaaggaaac gctgcctgag aagcgctata cgttgatcgt ggccttgctt       840
     gctcacatgc gcgtgcgcag tcgcgacgat ctcgccgaaa tgtttatccg gcgtatgggc       900
     gcgatccaca agcgggccca ggacgaactg gaatacatcc agtctcgcca gcgcgccaag       960
     ctcgaaggcc ttgtcaccgt gctggacggt gtcgtcgata tcgtcgccga tggcggtgac      1020
     gatgcccgaa tcggcgcgca ggtgcgcaag ctgttggctc ccaatggcga cctggagccc      1080
     ctgcgcgagc gctgcgccga agtgcgggct ttcagcggca acaactatct gccgctgttg      1140
     tggcggcact tccgcgccca ccgttcggtg atgttgcgcc tcgcccgcgt gttggagtgg      1200
     gagtcgacca gccaatcacg cacgttgtta gccgggctgg aggtcgcgct ggaaaacgaa      1260
     tcactgcacc gggagtggat cgctgctgaa gtcgatctca gttttgcctc cgagcgctgg      1320
     cgcaagctgg tccggcgagc gcaccacgag ggtccgccca ccaaccggcg ctacttggag      1380
     ttgtgcgtgc tgtcccacat ggtcaacgag ttgcgctcgg gtgatctgtg cgtggtgggg      1440
     tcagacgcct ttgccgacta ccggggccac ctgttgccgt ggcgcgagtg cgagcggcgc      1500
     ttgccagagt actgcgccaa gctggatctg ccggccaacg cgcaggagtt cgtcgcgcac      1560
     ctcaagcagt ggctggccga cgccgcgcag acgctggaca aaagttttcc ggacaagcgc      1620
     cagcacgtca ccatcagcgc tgacggcgaa cccttactca agcgcaccgc tgcgcgcgaa      1680
     actccgccct cggccgttgc cttgcagcag gcgctgatcc gccgcatgcc gacgcgcaac      1740
     ctgctcgacg tgctggccaa tatcgagcac tggacccagt tcacccggca cttcgggccg      1800
     ctctccggca acgatcctaa gatccgcaac gccgccgaac gctatctgct gacgatcttc      1860
     gcgatgggtt gcaatctcgg acccactcaa gctgcgcgcc atatgggcga tcgcgtcacc      1920
     ccccatatga tgtcgttcgt caaccggcgg cacatgagcc tggagaagct ggagaccgcg      1980
     cagcgcgagc tgatcgagct gtacctgcgc ctggatttgc ctaaacactg gggcgacggc      2040
     aaaacggtgg ccgccgacgg tacccaatac gacttctacg acaacaatct gctggccggc      2100
     tatcattttc gttaccacaa gatgggcgcc gtggcttacc ggcatgtggc cgacaattac      2160
     atcgcggtgt ttcggcactt catcccgcct ggtgtgtggg aagccatcta tgtcatcgaa      2220
     gggctgctca aggccaacct gagcgtcgag gccgacaccg tgcacgccga cacgcagggg      2280
     cagtcggcgg cggtcttcgc tttcacccac ttgcttggca tcaatctgat gccccgcatt      2340
     cgcaactgga aggaactgga tctgtacaag cccgatgccg gcgtcaaata caagcacatc      2400
     gattcgttgt tctcggcggt ggtcgactgg gatctgatcg cttttcactg gcaggacctg      2460
     atgcaggtgg cgctgtcgat ccaggccggc accatctctt cgccgctgct gctgcgcaga      2520
     ttgggctcgg agagccgcaa gaaccgcctc tacctggccg cgcgagaact gggcaacgtc      2580
     gtgcgcaccg tgtacctgct cgaatgggtc ggcagtcgcg agctgcgcca ggaagtgacc      2640
     gccaccacca acaagatcga gtcgtacaac ggctttgcga agtggttctc gttcggtggt      2700
     gacgtgatcg cggaaaacga gcccgaggag cagcagaaac gcctgcgcta caacgacctg      2760
     atcgcctcgg ccgtgatcct ccagaacacc gcagacctga tgcaggccct acgcacgatg      2820
     gtcagcgagg gcatcaaagt gaacgtcgcc gacatcgaat tcctgagtcc ttatctgacc      2880
     cacaacatca agcgctttgg tgactacaag ctgcacctag agcgcgtacc ggaggcctgg      2940
     attcgcgatg ggttgttcgc gggacccgcc cgcgctgtcc gcagggctcg ccatgcctga      3000
//

If you have problems or comments...

PBIL Back to PBIL home page