(data stored in SCRATCH zone)

EMBL: CP001069.PE554

CP001069.PE554       Location/Qualifiers
FT   CDS_pept        complement(642769..643962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4335"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bmu:Bmul_5789
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29430"
FT                   /db_xref="GOA:B2UE97"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2UE97"
FT                   /protein_id="ACD29430.1"
FT                   /translation="MTHPVPSFNGPAVAIEQLRIPPALSGLHGANRAREASRQITADDD
FT                   LAAVAAWLARYAGVPGTVATYRKEAERLILWAILQHGKPLSSLTHEDLLLYERFLADPQ
FT                   PAWRWVMASRKKLARSSPDWRPFAGPLSPTSVRHAMTILNALFAWLVQAGYLAGNPLSL
FT                   ARRRSAKTAPRVTRYLTHAHWDIVKATIETLPVATERDRLHAARCRWLFSVLYLAGLRL
FT                   AEIASTRMGAVFSRRDAAGVERWWIEVHGKGGKTRLVPATDELIAELARYRRICGLPPS
FT                   PQIGETRPLLLPVIGPEKPLSRAAIHLIVKEVFKLAADRVRAQGPEFGAQADVLASASS
FT                   HWLRHTAGSHMSDQQVDLRFVRDNFGHASLATTSVYLHAEDDARHQATQASHRLGWN"
     atgacccatc ccgttccatc gttcaacggt cccgcggtgg ccatcgagca gttgcgcatc        60
     ccgccagcgc tctcgggcct tcacggcgcc aaccgcgcac gcgaagcgag ccgccaaatc       120
     acggcggatg acgacctggc cgccgtggct gcgtggctcg cccgctatgc cggcgtgccc       180
     ggcacggtcg ccacctaccg caaggaagcc gaacgcctga tactgtgggc gattctccag       240
     cacggcaagc cgctgtcttc actcacccac gaggacctgc tgctctacga gcgcttcctg       300
     gccgacccgc agccagcttg gcgttgggtg atggcctcac gcaagaagct ggcgagaagc       360
     tcgcccgact ggcgcccctt cgccggtcca ctgtcgccca cgagcgtgcg gcatgcgatg       420
     acgatcctca acgcgctctt cgcctggctg gtgcaagccg gatacctcgc cgggaatccg       480
     ctctcgctcg cgcgccgtcg cagcgccaag acagccccgc gcgtgacgcg ctacctcacg       540
     catgcgcatt gggacatcgt caaagccacg atcgaaaccc tgcccgtcgc gacggaacgc       600
     gaccggctgc acgcggcccg ttgccggtgg ttgttctccg tgctgtattt ggccggcctg       660
     cgcttagcgg aaatcgcctc cacgcgcatg ggcgccgtgt tctctcgccg ggacgcggcg       720
     ggcgtcgagc gctggtggat cgaggtgcac ggcaaaggcg gcaagacgcg cctggtgccc       780
     gccaccgatg aactgatcgc ggagctggcg cgctatcggc gcatctgcgg cctgccgccg       840
     tcaccgcaga tcggcgaaac acgccctttg ctgctgcccg tgatcggccc ggaaaagccg       900
     ttatcgcgcg cggcgattca cctgatcgtc aaggaggtgt tcaagctcgc ggccgaccgc       960
     gtgcgtgcac agggtcccga gtttggcgcg caggctgacg tgctcgccag cgcatcgtcc      1020
     cactggctgc gccacacggc cggctcgcac atgtccgacc aacaggtgga cctgcgcttc      1080
     gtgcgtgaca acttcggcca tgcgtcgctc gccacgacga gtgtctacct ccacgcggaa      1140
     gatgacgcac gccaccaggc aacgcaagcc agccaccggc ttggctggaa ctga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page