(data stored in ACNUC7421 zone)

EMBL: CP001069.PE56

CP001069.PE56        Location/Qualifiers
FT   CDS_pept        complement(66878..67603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3818"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bpt:Bpet1842
FT                   transcriptional regulator, ArsR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3818"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28932"
FT                   /db_xref="GOA:B2UH81"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH81"
FT                   /protein_id="ACD28932.1"
FT                   /translation="MSHPNSFSGTAFLLADPARAAMLTALLDGHALPAGELAHAAGITA
FT                   QTASTHLAKLLDGGLVVVETEGRHKYFRLAGEHVAQALEHLAAITPSAVVRRTTPSPTA
FT                   RELGFCRCCYDHLAGQVGVAVTQALQSHGYLLPMPDKQYEITPAGIAWFGDVGLNVQDI
FT                   RPTRRGLARQCLDWTERAHHLAGPLGVHFLRRLCDAGWMLRARNSRAVLVTPKGWQELH
FT                   QRLGVDEATVRSDAGHRHA"
     atgtcgcatc cgaacagctt ttccggcacg gcgttcctgc ttgccgaccc cgcgcgtgcc        60
     gccatgctca ccgccctgct tgacgggcac gcgttgcctg cgggcgagct tgcccatgcg       120
     gctggtatca ccgcgcagac ggccagcacg cacctggcca agttgctcga cggtggcttg       180
     gtggtggtgg aaaccgaggg gcgccacaag tacttccggt tagcgggcga gcatgtggcg       240
     caagcgctgg aacatctggc cgcgatcacg ccctcggccg tggtacgccg gaccacgccc       300
     agcccgacag cgcgcgaact gggcttctgc cgctgctgct atgaccacct tgcggggcag       360
     gtaggcgtag ccgtcacaca ggcgctgcaa tcacacggct atctgctgcc gatgccagac       420
     aagcaatacg agatcacgcc cgcgggcatc gcgtggtttg gcgacgtggg gctcaatgtg       480
     caggacatcc gcccgacgcg acgcggcctg gcgcggcaat gcctggactg gaccgagcgc       540
     gcgcaccacc tggcggggcc gttgggcgtg catttcctgc gtcgtctgtg cgatgcgggt       600
     tggatgctgc gggcacgcaa ctcacgcgcg gtgctggtca cgcccaaggg ctggcaagaa       660
     ctgcatcagc gcctgggcgt ggatgaagca acggtgcgca gcgacgccgg acatcgtcat       720
     gcatag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page