(data stored in SCRATCH zone)

EMBL: CP001069.PE560

CP001069.PE560       Location/Qualifiers
FT   CDS_pept        complement(647610..647912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29436"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN5"
FT                   /protein_id="ACD29436.1"
FT                   /translation="MSIKEAIDFLKQRGRFDSYAALARAAGMDRIRMQNIRAGVASPSV
FT                   KEEFALAEACGMKPADAVALLEAAKDPESRSFWKKYSEVFRRPLNAPNRGRLLKA"
     atgtccatca aagaagcgat tgattttctt aaacaaagag ggaggttcga tagctacgct        60
     gcactagcaa gagcagcggg catggaccgc atccgaatgc agaacatccg ggccggcgta       120
     gcctcgccga gcgtgaaaga agagttcgcg cttgcagaag cctgcggaat gaagccagca       180
     gacgcagttg cgttgctgga agcggcgaaa gaccccgaga gcaggagctt ctggaaaaag       240
     tacagtgagg tttttcggag gccacttaac gccccgaatc ggggtcggct gctgaaagcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page