(data stored in ACNUC7421 zone)

EMBL: CP001069.PE564

CP001069.PE564       Location/Qualifiers
FT   CDS_pept        648984..649229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29440"
FT                   /db_xref="GOA:B2UIN9"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIN9"
FT                   /protein_id="ACD29440.1"
FT                   /translation="MAQCVVWQAGALVATTDAPEQCQGFLLMQTNEYATAMTLGSAFEM
FT                   PTADQIGAAWSVGFCLPVLCYLIARSCRSITDVFER"
     atggcgcagt gcgtggtgtg gcaagccggt gcgttggttg cgaccacgga tgcgcctgag        60
     caatgccaag gttttttgtt gatgcaaacc aacgaatacg ccacggcgat gacgttggga       120
     tcagcgttcg aaatgccgac agcagaccaa attggagcgg catggtctgt cggtttttgt       180
     ctcccggtgc tgtgctacct gattgcacgg tcatgtcgct ctatcacaga cgtttttgag       240
     aggtga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page