(data stored in ACNUC7421 zone)

EMBL: CP001069.PE567

CP001069.PE567       Location/Qualifiers
FT   CDS_pept        651127..651456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4348"
FT                   /product="minor coat protein"
FT                   /note="KEGG: xcb:XC_2118 minor coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29443"
FT                   /db_xref="GOA:B2UIP2"
FT                   /db_xref="InterPro:IPR019670"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP2"
FT                   /protein_id="ACD29443.1"
FT                   /translation="MFDAVINALSAFANWLLSGFVAVFVALWQIEEDLFIDGFDLLLNG
FT                   FSSVLSILPTPTFLTAVSLQSLFGQLGSDALFFVGQFRVGEGLALVGAAFAFRMARKVV
FT                   TLFQW"
     atgtttgatg cagtgatcaa cgccctgtcg gcgtttgcga attggctgct gtctggcttc        60
     gttgcggtgt tcgttgccct ctggcagatc gaagaggatc tgttcattga tgggttcgac       120
     ctgctgctca acggctttag ctcggtgctg agcatcttgc cgacgccgac gtttttgacg       180
     gcggtgagcc tgcaatcgct gttcgggcag ttgggcagtg atgcgctgtt cttcgtgggc       240
     cagtttcgcg ttggcgaagg cctagccttg gtgggtgcgg cgttcgcgtt tcgcatggca       300
     cgcaaggtcg taaccctctt ccagtggtga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page