(data stored in SCRATCH zone)

EMBL: CP001069.PE568

CP001069.PE568       Location/Qualifiers
FT   CDS_pept        651461..652792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4349"
FT                   /product="Zonular occludens toxin"
FT                   /note="PFAM: Zonular occludens toxin; KEGG: xcb:XC_2117 pI
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29444"
FT                   /db_xref="GOA:B2UIP3"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP3"
FT                   /protein_id="ACD29444.1"
FT                   /translation="MFIFHEGLPRSGKSYEAMVKRIIPALLKGRKVYARLNGINHEKVA
FT                   EAAGMPVEQVRALLFEIPESKVLLWHTIVENDSLVILDEMQNFWPESVRNIPQDQLKAI
FT                   TEHGHRGLDIVGMGQLLKGKGGVNANWVNRCDQKIVFEKQNAQGRDDHYRWTSYKGKLE
FT                   NGRIKFVKIASEVEKYDPKYFGTYATRVEGAENAETYKDDRTNILRSRLFRLWVPLGVV
FT                   AFAVCLGYLWHLLRGGGMEKSLLKNQPQHNVVTTTSTVSTPASGVVATSAQPMQQPSQA
FT                   AATTQPAKADALADDYIVAITGKWRPRLSGLIVGGRKARVVVEWYDDGYRVRERLSAAQ
FT                   LEEFGWLVVRSAYGEHVVLSKQGTHIAVTAWPMEPYAAVSEVQQGEIRNAGRNVGFGGG
FT                   EAPVPYGDVRQVAAAGGGDDPSWNGYGADGLIRHHKPVHSILSN"
     atgttcatct ttcatgaagg ccttccaagg tcgggcaagt cttacgaggc catggttaag        60
     cggatcattc cggcgctctt gaaggggcgg aaggtctatg cgcggctgaa cggcatcaat       120
     cacgagaagg ttgctgaagc tgctggcatg ccggttgagc aagtccgtgc gttgctgttc       180
     gagattcccg agagcaaggt gctgctgtgg cacaccatcg tcgaaaacga ttcgctggtg       240
     atcctcgatg agatgcagaa cttctggcct gagagcgtgc gtaacattcc gcaggatcag       300
     ttgaaggcga tcactgagca cgggcaccgt ggccttgata tcgttggcat ggggcaactg       360
     ctgaagggta agggcggcgt caacgcgaac tgggtgaacc gctgcgatca gaagatcgtg       420
     ttcgagaaac agaacgctca ggggcgagac gatcactacc ggtggacgtc gtataagggc       480
     aagctcgaaa acggtcgcat caaatttgtc aagatcgcct ctgaggtcga gaaatatgac       540
     ccgaagtact tcggcaccta cgcgacgcgg gtcgagggcg cagagaacgc ggagacgtac       600
     aaagatgatc gcaccaacat cctgcgctct cgcttgttcc gtctttgggt cccgctcggc       660
     gtggtggcgt ttgcggtctg tctcggctat ctgtggcacc tcttgcgagg cggtggcatg       720
     gaaaagtcgc tgttgaagaa ccagccgcaa cacaacgtgg tgaccactac aagcactgtg       780
     agcacgccgg cgtcaggggt tgtcgcaacc tcggcgcaac cgatgcagca gccatcgcag       840
     gctgcggcta ctacgcagcc cgcaaaggcc gatgccctag cggatgacta catcgtggcg       900
     atcacaggta aatggcggcc tcgcctgtct ggcctcatcg tcggaggtcg caaggcgcgc       960
     gtggtggtcg agtggtacga cgatgggtat cgcgtgcgcg aacgtcttag cgctgcgcaa      1020
     ctggaagagt tcggttggct cgtggtgcgg tcggcgtatg gcgagcacgt ggtgctgagc      1080
     aagcagggca cgcacatcgc cgtgacggcc tggccaatgg agccgtatgc ggccgtgagt      1140
     gaggtccagc aaggtgagat tcgcaacgcc ggccgcaacg ttgggttcgg tggtggtgag      1200
     gctcccgtgc cctatggcga tgttcggcag gttgcggccg ctggtggcgg tgacgatccg      1260
     agctggaacg ggtatggcgc cgatggcttg attcggcatc acaagccggt gcattcgatc      1320
     ttgagcaact ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page