(data stored in SCRATCH zone)

EMBL: CP001069.PE569

CP001069.PE569       Location/Qualifiers
FT   CDS_pept        653239..654120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29445"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP4"
FT                   /protein_id="ACD29445.1"
FT                   /translation="MRHDIVGERATFEKGYCYQEGIAIRHRVFPDGQVEVNGFPTTDWS
FT                   RCKAMQAMPKAKRGESENRDTNVESAARRAKQALRLKCKAIGADHMLTLTTRANIEDLD
FT                   EFHKLFKRWARIMSTSKRLNYVAVPERQERGAWHLHVAINGKPARWRAIRVWLRVVGGK
FT                   GEGYVHLRSPDGGHYGQGWEQHKLAGYISKYIGKDVGVAALNRKRYWASQGIDVPAKAT
FT                   YCTWMGYPSMYEVLKVVMADLQHQFGVHDVVARVSARDGAFWLSTGPRPGHAFAPPSPF
FT                   VTEYERFLGARS"
     atgcgccatg acatcgtagg tgaacgggct acttttgaaa agggttattg ctatcaggaa        60
     ggcattgcca ttaggcatcg tgtatttccg gatggtcagg ttgaagtcaa cgggttccct       120
     accacggatt ggtcccgttg caaggccatg caggccatgc ccaaggccaa gcgaggcgag       180
     tcagagaacc gggacacaaa cgtcgagtca gcggcacggc gtgccaaaca ggcactgcgc       240
     ctgaagtgca aggccatcgg ggctgatcac atgctgacac tcacgactcg ggcgaacatc       300
     gaggacttgg acgagttcca caagctgttc aagcgctggg ctcgcatcat gtcgacctca       360
     aagcggttga actatgtagc tgtgccagag cgtcaggagc gtggtgcgtg gcaccttcac       420
     gtggcgatca acggcaagcc tgctcggtgg cgcgcaatcc gcgtctggct gcgcgttgtg       480
     ggcggtaagg gtgaggggta cgttcacctg cgttcgcccg atggcggcca ctatgggcaa       540
     ggctgggagc agcacaagtt ggcgggctac atcagcaaat acatcggtaa agacgtgggc       600
     gtggcggcgt tgaaccgcaa gcgctactgg gcgagtcagg gcatcgatgt gccggctaag       660
     gcgacctact gcacgtggat gggctaccca tcgatgtacg aggtgctcaa ggtggtcatg       720
     gctgacctgc aacaccaatt cggcgtgcac gacgtggtgg ctcgggtgag tgccagagac       780
     ggtgctttct ggctgagtac ggggcctaga ccggggcatg ccttcgcccc gcctagcccg       840
     tttgtgactg agtacgagcg gtttctgggt gcgcgctcgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page