(data stored in SCRATCH zone)

EMBL: CP001069.PE572

CP001069.PE572       Location/Qualifiers
FT   CDS_pept        657655..658620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4353"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG:
FT                   bvi:Bcep1808_5897 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29448"
FT                   /db_xref="GOA:B2UIP7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP7"
FT                   /protein_id="ACD29448.1"
FT                   /translation="MKRLYKSLAPRHYRSGEAAKLARMSASTLRIWERKYAVVAPPKSA
FT                   SGQRLYTEEDIERLRLIRGLVDSGHAIGAVASLNVESLRALVRSSGTVHAAKGEPISLL
FT                   MVGPVPIAIANSASDSMYVCGHPGSLEEAFRDARAGLRADALLVAVPSLTEDTILRIVA
FT                   LAEAAHAKAISVIFTSGTPRAIERASLGGLRVVPQSDAEVRPESLIAELVDWATALRQA
FT                   DILNADTRSRAARRFDDKALAAFAGLTSTIQCECPRHLAELVIQLSAFQRYSDACLSRS
FT                   PRDALLHRRLGNVANRAVQLLETALAEVVRHEDLLNSAKR"
     gtgaaaaggc tctataagtc attggccccc agacattacc gaagcggcga agcggcaaaa        60
     ctggctcgca tgtcggcatc caccttgcgc atttgggaac gcaaatacgc tgtcgtcgcg       120
     ccgccgaaaa gtgcatcggg ccaacgtctc tacacagagg aagacataga gcgcttgcgc       180
     ctgatcagag gtcttgtcga ttccggccac gctatcggtg cggttgcgag tctcaatgtg       240
     gagtctctaa gggctctcgt gcgatcgtcc ggaaccgttc atgcggcaaa gggcgagcct       300
     atttcgcttt tgatggtagg gccagtgccg attgccatcg cgaattcggc ctcagacagc       360
     atgtatgttt gcggacatcc cggatcgctt gaagaagcgt ttcgggacgc gcgagcagga       420
     ttgagggcgg atgcgttgct tgtcgccgtt ccttcgctca cggaggacac catcctacgc       480
     attgtggcgc tggcggaagc ggcgcacgca aaagcgatca gcgtgatctt cacatcgggc       540
     acaccccgcg caattgaacg ggcgagcctc ggtggcttgc gtgtagtgcc acaatccgat       600
     gctgaagtca ggccggagtc gctgatcgca gagctggtcg attgggctac ggccctccgc       660
     caggcagaca ttttgaacgc tgacacgcgc tcgcgcgcgg cgcgtcgctt cgacgacaag       720
     gcgctcgctg ctttcgcggg gctgacttca acgatccagt gcgagtgccc acggcacttg       780
     gccgaactcg taatccaact cagtgcgttc caacgttaca gcgatgcgtg cctatcccgc       840
     tcgcctcgcg atgcgttgct gcatcgccgt ctcggtaacg tcgcgaatcg tgcggtacag       900
     ctgcttgaga ccgccctggc tgaggtcgtg cgtcacgaag acctgctcaa cagtgccaag       960
     cgctaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page