(data stored in SCRATCH zone)

EMBL: CP001069.PE574

CP001069.PE574       Location/Qualifiers
FT   CDS_pept        659482..659937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_5841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29450"
FT                   /db_xref="GOA:B2UIP9"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIP9"
FT                   /protein_id="ACD29450.1"
FT                   /translation="MSTHTTSVRGLAVLLGITGLIPFIVLTGLCLGDTSSRGEYQRSLL
FT                   VYATSITSFVGAVHWGLALRAETATRMHTLQLAWSIVPSLAAWAVAVSSEPPAALVRMA
FT                   IVLAICWLTDAGFARCGAIPAWYFRLRSVLTLVATASLALSGFASAR"
     atgagtacgc atacgacaag cgtacgcggc ttggcagtcc tactcgggat caccggcctc        60
     ataccgttta tcgtgctgac cgggctatgt ctgggggaca catcgagccg cggtgaatac       120
     caacgctcgc ttctggtgta cgcgacgtcc attacgtcgt tcgtaggtgc agtgcactgg       180
     ggtctcgccc ttcgcgcgga aaccgcaacg cgcatgcaca ccttgcagct tgcctggagc       240
     attgttccat cgctcgcggc atgggccgtg gccgtcagca gcgagccgcc cgccgctctt       300
     gtcaggatgg caatcgtgtt ggccatctgt tggttgacgg atgcagggtt tgcgcgttgc       360
     ggagcaatac cggcctggta ttttcggtta cgcagcgtac tgacccttgt agcaacggcg       420
     tcgctagcgc tttcgggttt tgcaagcgcg cgctaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page