(data stored in ACNUC7421 zone)

EMBL: CP001069.PE575

CP001069.PE575       Location/Qualifiers
FT   CDS_pept        659967..660443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4356"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: rso:RSc1996 putative transmembrane succinate
FT                   dehydrogenase (cytochrome b-556 subunit) oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29451"
FT                   /db_xref="GOA:B2UIQ0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ0"
FT                   /protein_id="ACD29451.1"
FT                   /translation="MLRQTKQSHLLRNLFEVCLEDHVAIDSKNGAVIYRNIGLGDIARY
FT                   RLPWAGKVSILHRASGALMFLLLPFVLYLFEQSLTSEISFAKFSALLSNGFAKVVVLAL
FT                   IWAYLHHFCAGVRYLILDLHIGIDKASASKSAVSVLIVSLLLTVVFGAKLFGLF"
     atgttgcgtc aaactaaaca atctcatctg ctcaggaatc tgtttgaagt ctgtttggag        60
     gaccacgtgg caatcgattc aaaaaacgga gcggtcatct acaggaacat cggtttgggc       120
     gacatcgccc gctaccgctt gccctgggcc ggtaaggtgt ccatcctgca ccgtgccagc       180
     ggtgcgctga tgttccttct tcttccgttc gtgctgtact tgttcgaaca aagtctcacg       240
     tcggaaatca gtttcgccaa gttctcggcg cttctgtcca acggttttgc caaggtcgtc       300
     gtcctcgcgc tcatctgggc ttatctgcac catttctgcg ctggcgtccg ttacctgatc       360
     ctcgatctgc atattggcat cgacaaggct tcggcctcca agtcggctgt gagcgtgctg       420
     atcgtcagcc tgctgctgac cgtcgtgttc ggcgccaagc tgttcggcct gttctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page