(data stored in SCRATCH zone)

EMBL: CP001069.PE577

CP001069.PE577       Location/Qualifiers
FT   CDS_pept        660823..662601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4358"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: rso:RSc1994 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29453"
FT                   /db_xref="GOA:B2U701"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B2U701"
FT                   /protein_id="ACD29453.1"
FT                   /translation="MVAVKTGLPRRKFDVVIVGAGGSGMRASLQLAEAGLSVAVLSKVF
FT                   PTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTVKGSDWLGDQDAIEFMCRQAPNVVYEL
FT                   EHFGMPFDRNADGTIYQRPFGGHTSNYGEKPVQRACAAADRTGHALLHTLYQRNVKAKT
FT                   HFFVEWMALDLIRDQDGDVLGVTALEMETGEVYILEAKTTLFATGGAGRIYAASTNAFI
FT                   NTGDGLGMAARAGVPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILRNKDGERFMERY
FT                   APTLKDLAPRDFVSRSMDQEIKEGRGCGPNGDYVLLDLTHVGAETIMKRLPSIREIGLK
FT                   FANVDAIKEPIPVVPTIHYQMGGIPTNYHGQVVVPKNGNPNEVINGFYAIGECSCVSVH
FT                   GANRLGTNSLLDLVVFGRSAGNHIIAQNLKNREHKPLPADAADRALSRLAKLDSSSSGE
FT                   YAQDVANDIRRNMQSHAGVFRTQKLMDEGVERILEVAERAGNIHLKDKSKVFNTARVEA
FT                   LEVANLVEVAKATMVSAAARKESRGAHAHSDFPNRDDENWMKHSLWYSEGNRLDYKPVQ
FT                   LKPLSVESVPPKARTF"
     atggtcgcag tcaagactgg gctgccgcgc cgcaaattcg acgtcgtgat cgtcggtgcg        60
     ggcggttcgg gcatgcgcgc atcgctgcag ctggcagaag ccggcctctc cgtggccgtg       120
     ctgtccaagg tgttccccac ccgctcgcac accgttgcgg cgcagggtgg tatcggtgct       180
     tcgctgggca acatgagcga agacaattgg cactatcact tctacgacac cgtcaagggt       240
     tccgactggc tcggcgacca ggacgcgatc gaattcatgt gccgccaggc gccgaacgtg       300
     gtctatgaac tggaacactt cggcatgccg ttcgaccgca acgccgacgg caccatctac       360
     cagcgtccgt ttggcggcca tacgtcgaac tacggcgaga agccggtgca acgcgcttgc       420
     gccgccgccg accgtaccgg tcacgcgttg ctgcacacgc tgtatcagcg caacgtcaag       480
     gccaagaccc acttcttcgt cgaatggatg gcgctggatc tgatccgcga tcaggacggc       540
     gacgtgctgg gcgtgaccgc gctggagatg gaaaccggcg aggtctacat cctcgaagcc       600
     aagacgacgc tgttcgccac gggcggtgca ggccggatct acgcggcttc caccaacgcc       660
     ttcatcaaca cgggtgacgg cctgggcatg gcggcacgcg caggcgtgcc gctggaagac       720
     atggagttct ggcagttcca cccgactggc gtggccggcg cgggcgtgct gatcacggaa       780
     ggcgtgcgcg gcgaaggcgg catcctgcgt aacaaggatg gcgagcgctt catggagcgc       840
     tatgccccga cgctgaagga tctggcgccg cgtgacttcg tgtcgcgctc gatggaccag       900
     gaaatcaagg aaggccgcgg ctgcggtccg aacggcgact acgtgctgct cgacctgacg       960
     cacgtcggcg ccgagaccat catgaagcgc ctgccgtcga ttcgcgagat cggcctgaag      1020
     ttcgccaacg tcgacgccat caaggaaccg attcccgtgg tgccgaccat ccactaccag      1080
     atgggtggca ttccgacgaa ctatcacggc caggtggtgg tgccgaagaa cggcaacccg      1140
     aacgaggtca tcaacggctt ctacgcgatc ggcgaatgct cgtgcgtgtc ggtgcacggc      1200
     gccaaccgcc tgggcacgaa ctcgctgctc gacctggtgg tgttcggccg ttcggcgggt      1260
     aaccacatca ttgcgcagaa cctgaagaac cgcgagcaca agccgctgcc ggccgacgcc      1320
     gccgaccgcg cgctgtcgcg cctggccaag ctcgattcgt cgagctcggg cgagtacgcg      1380
     caggacgtcg ccaacgacat ccgccgcaac atgcagtcgc acgctggcgt gttccgtacg      1440
     cagaagctca tggatgaagg cgtcgagcgc atcctggaag tggccgagcg tgctggcaac      1500
     atccacctga aggacaagtc caaggtgttc aacaccgcgc gcgtcgaagc gctggaagtg      1560
     gccaacctgg tggaagtggc gaaggcgacg atggtgtcgg ctgccgcccg caaggaatcg      1620
     cgcggcgcac acgcccacag cgacttcccg aaccgcgacg atgaaaactg gatgaagcac      1680
     tcgctgtggt attccgaagg caaccgcctg gactacaagc ccgtgcagtt gaagccgctg      1740
     tcggtggaat cggtgccgcc caaggcgcgt acgttctaa                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page