(data stored in SCRATCH zone)

EMBL: CP001069.PE583

CP001069.PE583       Location/Qualifiers
FT   CDS_pept        666648..667334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29459"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIQ8"
FT                   /protein_id="ACD29459.1"
FT                   /translation="MSPRSGLRRYALPSIAAFTVAIGLVGAMHLKAARPVLAMLGVPCP
FT                   VDNTTAEQVSALRASGLAHLRAVKLAPARPVPGGFVLDATTPEEARQWAHENRIACEDV
FT                   KHGYSYLRCRGVDANKLGLAGPPVSELWLSFGPNGHLIGVDVYRRGMSANDTTAAWDGA
FT                   SYALRDVLGVPTSTMGDASPAVLGGSPLQTARLQWRFSDYVAIVTASNLPYAGLAVREQ
FT                   YMSSRL"
     gtgagcccgc gaagcgggtt gcgccgctac gcactgccca gcattgcagc ctttacggtt        60
     gcaatcggtc tggtcggtgc aatgcacttg aaggcggctc gtcctgtgct cgcgatgctt       120
     ggcgttccgt gccccgtcga caacaccact gcggagcaag tcagcgcgct gcgcgccagc       180
     ggactagcgc accttcgggc tgtgaagctc gcgccagctc gccccgtccc cggcgggttc       240
     gtactggatg ccacgacccc cgaggaggcc cgccagtggg cacacgaaaa tcgcatagcc       300
     tgtgaagatg tcaagcacgg ctacagctat cttcgttgtc gcggcgtcga cgccaataag       360
     ctcggtcttg ccggtccgcc cgtcagcgag ttatggctca gcttcggtcc aaatggccat       420
     ctgatcggtg tggacgtcta ccggcggggt atgagcgcca acgacacaac cgccgcctgg       480
     gacggcgcta gttatgcgct gcgagatgtg ctcggtgtgc caacgtcgac aatgggtgat       540
     gcatcgccag cggtactggg cggatcgcca ctgcagaccg cacgtttgca gtggcgattt       600
     tccgactacg tggcaatcgt caccgcgagc aacctgcctt acgccgggct ggcggtccgg       660
     gaacagtaca tgtcgtctcg cctttga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page