(data stored in ACNUC7421 zone)

EMBL: CP001069.PE585

CP001069.PE585       Location/Qualifiers
FT   CDS_pept        complement(668002..668181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29461"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR0"
FT                   /protein_id="ACD29461.1"
FT                   /translation="MLTRRRRSALDTAETELTLIASVAVMGDSSKLACRIYFCIMPPVP
FT                   GPIPRPMPMPIPVP"
     atgctcacgc ggcgcagacg cagcgcattg gataccgccg aaaccgaact cacgctcatc        60
     gcgagcgtcg cggtcatggg agacagcagc aagctggcct gccgaatcta cttctgcatc       120
     atgccgcccg tacccggacc cattccgcgg cccatgccca tgcccattcc cgtgccctga       180
//

If you have problems or comments...

PBIL Back to PBIL home page