(data stored in ACNUC7421 zone)

EMBL: CP001069.PE586

CP001069.PE586       Location/Qualifiers
FT   CDS_pept        complement(668197..669372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4367"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: bte:BTH_II0064 efflux transporter, RND
FT                   family, MFP subunit subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29462"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR1"
FT                   /protein_id="ACD29462.1"
FT                   /translation="MKRGGLRKTLALASAALALALALTYALWPVPAAVDTGRVTRGPLQ
FT                   VTIDEDGEIRAHDRYVITAPITGRLLRVELHEGDQIKAGQVIAVLVPVPMTPGERAAQR
FT                   ARVDAAEAIFSEAQARAAHARADYDQARRNLDRGETLLSSGAMSRQEVEQMRTMAASSA
FT                   SDLTAARARETSAAADVRVAMANLKALEAGQPVEVRAPTNTVLLRIEQQSERVVLAGAA
FT                   LMLLADPSRYELVVDVLSTDAVKISPGMRVSVVEWGGPWAVNATVRTVGPGAFTKVSAL
FT                   GVEEQRVHIVADLVDPPGRLNDGYRVQGRIVIWEQPDVLKLPIGALFRCGGNWCTFIVK
FT                   NGKAVQRIIQIGQRNAEEAQVLDGLQDHDTVVVYPPTTLSDSMSVRPLNAR"
     atgaagcgtg gtggcctgcg aaagacgctc gcacttgcaa gtgctgcgct ggcgctggca        60
     ttggcgctca cgtacgcact ctggccggta cctgcggccg tggacacagg gcgtgtcacc       120
     cgtgggccgc ttcaagtcac gatcgatgaa gacggcgaaa tccgtgcgca tgatcgttac       180
     gtcatcactg cgcccatcac aggccgactg cttcgcgttg aactgcatga aggcgatcag       240
     attaaggcag ggcaggtgat cgccgttctg gtgccggtgc cgatgactcc gggagaacga       300
     gctgcccaac gcgcacgtgt tgatgcggca gaggcaattt tcagtgaggc ccaggcgcgg       360
     gccgcgcatg cgcgggcaga ctacgaccaa gcgcgccgaa acttggaccg gggcgaaacg       420
     cttttgagca gcggtgccat gtccaggcag gaagtggagc agatgcggac catggctgcc       480
     tcaagtgcca gcgatctgac agcagcacgc gcaagagaaa cgtccgccgc cgccgacgtt       540
     cgtgtcgcca tggcaaattt gaaggcgttg gaagccgggc aacccgttga agttcgtgcc       600
     ccgaccaata ccgttctgtt gcgcatcgag caacaaagtg agcgcgtggt gcttgcaggc       660
     gcggccttga tgcttctggc cgacccatcg cgctacgaac tcgtcgtcga cgtgctatcg       720
     accgatgcgg tcaagatcag tccgggcatg cgcgtatcgg tagtggagtg gggcggtccg       780
     tgggccgtca acgccacggt ccggacagta ggtccagggg cgtttaccaa ggtgtcggcg       840
     ctcggggttg aagaacagcg cgtccatatt gtggcggatc ttgtcgaccc gccaggcagg       900
     ttgaatgatg ggtaccgcgt acaaggccgc atcgtcatct gggaacaacc cgacgtactg       960
     aagctgccga ttggcgcgtt attccgctgc ggcggtaact ggtgcacgtt tatcgttaag      1020
     aacggaaaag ctgtacagcg aatcattcag atcggacagc gcaacgcgga ggaagcccag      1080
     gtgctcgatg ggcttcagga ccacgacacc gtggtcgtct atcctccgac cacgctcagt      1140
     gacagcatga gcgtgcgccc cctgaacgcc cgctga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page