(data stored in ACNUC7421 zone)

EMBL: CP001069.PE587

CP001069.PE587       Location/Qualifiers
FT   CDS_pept        complement(669369..671738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4368"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bte:BTH_II0063 permease, putative domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29463"
FT                   /db_xref="GOA:B2UIR2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR2"
FT                   /protein_id="ACD29463.1"
FT                   /translation="MVSMLVRLLWRDLWQMRAQVLAAVLVVGCGVATFVAMRSTYLALL
FT                   NAQQDYYASYRFADLFVHLKRAPLEIASRVAALPGVSHVDARVVSDVTVDIPGLSEPAT
FT                   ARLVSIPELGWPALNLLHLQSGRYIAPGREDEVLVSAAFADANSLRAGEYFSAILNGRW
FT                   KRLHIVGLAISPEYVYEAGAGSIFPDNRHYGIVWMGVNAVSAAFRMDGAFNDLVLSLDG
FT                   SVPAPHVIAQIDRTLLPYGGLGTISRDHQISNRFITDEIAQNRVTATYVPAIFFLVAMF
FT                   LLQNVLTRLIDTQRSQIGLMKAFGYGDLSVGLHYLQLGCVVAAAGTVVGIGGGLALGTY
FT                   LTDLYARYYRLAHLEFRADFSTMAWAFFISFGTAVGGAIASTAKAMRLMPVEALRAVVP
FT                   PAFSVGWVERAGIYRQMSVVWRMIARNIARQPVKSLLGSLAIACASAILVVGGFFFDSI
FT                   DFLFDTQFQQIERQDVTVAFSQPLSHRAIYAIERLPGVLKVEGFRDVPVKLSAGYRSRR
FT                   VSLSGIAQKADLHRLIDDEGRPLHMPPDGLVVSARLAAVLGIRPGDPITIEVLEGERQT
FT                   RQVTLMRLSGDLVGVAAYMDQHALAKLLGESGNWSGARLSVDQHAAAHLYATLKRLPAV
FT                   NAVAVRQSVIASFRKIMDESVRLSTSINFAFACVIAFGVAFNGMRIAYSERVQQLASLR
FT                   VLGFTQAEVAWILLGEQFVLTAIALPAGLLLGYGVCGLLSTRLATDLYRLPLVVHAATF
FT                   AYAFVVAGGAVVCSGLLVAAKIRRLDIVAVLKARES"
     atggtgagca tgcttgtccg gctactctgg cgagacctct ggcaaatgcg ggcgcaggtc        60
     ttggcggcag tcctcgttgt cggatgtggt gtcgccacgt ttgttgcgat gcgcagcacc       120
     tatctggctt tgttgaacgc ccagcaggac tactacgcgt cataccgttt tgccgatctc       180
     ttcgtgcatc tgaagcgcgc accactggag attgcctcgc gcgttgctgc attgcctgga       240
     gtgtcacatg tggacgcacg cgtagtgtca gatgtcacgg tcgacatacc cggcctttcc       300
     gagccagcca cggcgcgcct cgtttccatc ccggagctcg gttggcccgc gctcaacctg       360
     ctgcatcttc aaagcggccg atacattgcg ccgggcagag aggatgaggt gttggtcagc       420
     gcggccttcg cagatgccaa cagcctgcga gcgggcgagt acttcagcgc catcctgaac       480
     ggccgctgga agcgcctgca cattgttggt cttgcaatct cgccggagta tgtctacgag       540
     gcaggcgcgg gctccatctt cccggacaac cgccattacg gcatagtctg gatgggagtg       600
     aatgcggttt cggcagcgtt ccgcatggat ggcgctttca atgatctcgt gctgtctctc       660
     gatggcagcg tgcccgcgcc gcacgtcatc gcgcaaatcg atcgaacgtt gttgccgtac       720
     ggcggacttg gaacaatcag ccgcgatcac caaatatcga atcggttcat taccgacgag       780
     atcgcacaga accgcgtgac tgccacctat gtgccagcca tcttttttct ggtcgcaatg       840
     tttctgctgc agaacgtcct gacccgactg atcgatacac agcgctcaca gatcggcttg       900
     atgaaggcgt ttggatacgg tgacctttca gtcggtttgc attacctgca gctcggatgc       960
     gtcgttgctg cggcaggcac cgttgtcggt attggagggg gattggcgtt agggacatat      1020
     ctaaccgacc tctacgcccg gtactaccgg ctggcccacc tcgagtttcg cgccgatttt      1080
     tcgacgatgg cctgggcgtt cttcattagc tttggaacgg cggttggcgg tgccatcgcg      1140
     agcactgcga aagccatgag attgatgccc gtcgaggcgc ttcgcgcggt cgttccgcca      1200
     gcgttttcag tgggctgggt agagcgggcg ggcatctacc ggcaaatgag cgtggtgtgg      1260
     cgaatgattg cgcgcaatat cgcgcgccag cccgtcaagt cgctccttgg ttctttggcc      1320
     attgcgtgcg caagcgcgat tcttgtcgtc ggcgggtttt tcttcgattc aatcgatttc      1380
     cttttcgata cccaattcca gcaaatcgag cggcaggatg tgacggtggc cttttctcaa      1440
     cccttatccc accgagccat ctacgcaata gagcgtctgc ccggcgtgct gaaggtcgag      1500
     gggttccgcg atgtaccggt caagctatcc gcggggtatc ggtctcggcg cgtctcgctg      1560
     agtgggatcg ctcagaaggc ggatctgcac aggctaattg atgatgaggg cagaccgttg      1620
     catatgcccc cggacggctt ggtggtttcg gcccgactcg ccgccgtgct tggcataaga      1680
     cctggtgatc cgatcacgat cgaagtgctt gaaggagagc gtcaaaccag gcaagtcacc      1740
     ttgatgcggc tgtccggaga tctggtgggc gtcgcggcct acatggacca gcatgcactg      1800
     gcaaagctgc ttggggagag tggaaactgg tcaggtgcga ggctgtccgt cgatcagcat      1860
     gcggctgccc atctgtatgc gacgctcaag cgtctgccag cggtgaatgc agtggcggtt      1920
     cgccagtccg tcatcgccag cttccgcaag atcatggacg agagcgttcg tctgtccacg      1980
     tccatcaact tcgcctttgc ctgtgtgatc gcgtttggtg tggcgttcaa cggcatgcgc      2040
     atcgcttact cggaacgtgt tcaacagttg gcttccctgc gcgtactcgg gttcacgcag      2100
     gccgaagtcg cgtggattct gctcggggag cagtttgtgc tcaccgccat tgcgctgcca      2160
     gccggacttc tgctcggcta cggcgtgtgc ggtctcctct ctactcggct ggcaaccgac      2220
     ttgtaccgcc ttccgctcgt ggttcacgcc gcgaccttcg cttacgcatt cgttgtagcc      2280
     ggtggcgcgg tcgtgtgttc ggggctgctg gtggcggcca agatcagacg gttggatatc      2340
     gtcgcagtgc tcaaggcaag agaatcatga                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page