(data stored in SCRATCH zone)

EMBL: CP001069.PE588

CP001069.PE588       Location/Qualifiers
FT   CDS_pept        complement(671732..672436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4369"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bte:BTH_II0062 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29464"
FT                   /db_xref="GOA:B2UIR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR3"
FT                   /protein_id="ACD29464.1"
FT                   /translation="METVFNIQAVSKVYPMGSVSVRALEHVDLELGPGEIVVLLGASGS
FT                   GKSTLLNLMGGLDTPTSGSIVYRDHDLSHAGDRGLTRFRREHVGFVFQFYNLIPSLTAR
FT                   ENVALVTDIAEHPLDPTEALNRVGIGTLADNFPSQMSGGEQQRVAIARAVAKRPDVLLC
FT                   DEPTGALDFRTGQLVLEVLEQVNREFGTLIVIVTHNAVIADMADRVVRMSSGTIVEHRR
FT                   NGQRARVGDLAW"
     gtggaaacgg tgttcaatat tcaggccgtc agcaaggtct acccaatggg gagcgtgagc        60
     gtgcgcgctc tggaacacgt cgacctggaa ctcgggccgg gtgaaatcgt tgtgctgctc       120
     ggggcgtcgg gtagcggaaa atccacgcta ctcaacctga tgggcgggct ggatacacca       180
     acgagcggtt ccatcgtgta tcgggaccac gatctttccc acgcgggaga ccggggcctg       240
     acgcgtttcc gacgggaaca tgttggattc gtctttcagt tctacaacct gattccaagc       300
     ctgactgccc gcgagaacgt cgcactggtg acggacatcg cggagcatcc gctggatccc       360
     actgaggctc tgaacagggt cgggatcggg acgcttgcgg ataactttcc ctcacagatg       420
     tcgggtggtg agcagcaacg cgttgccatc gcccgcgcgg tcgcaaaacg gccagatgtc       480
     cttctgtgcg atgagccgac cggcgcactg gattttcgga ccgggcaact ggtgctggag       540
     gtgctcgaac aggtgaaccg cgagttcggc accctgatcg tgatcgtcac gcacaacgcc       600
     gtcatcgccg acatggcgga tcgtgtcgtt cgtatgagca gcggcaccat tgtcgagcac       660
     cgccgaaacg ggcagcgtgc ccgagtcgga gacctggcat ggtga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page