(data stored in SCRATCH zone)

EMBL: CP001069.PE589

CP001069.PE589       Location/Qualifiers
FT   CDS_pept        complement(672451..672741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS00827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29465"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR4"
FT                   /protein_id="ACD29465.1"
FT                   /translation="MSAWAIEQHRGCSIHILVVVGRCDGFKYAYTGFVCSPKQAALEYP
FT                   KLERFHHVSPDFDSVDVAIAAGMQVGRAIAERWTSHSAQHQTSERPTRPPS"
     atgtcggcct gggcaattga acagcaccgt ggctgctcca ttcatattct ggtggtcgtt        60
     gggcgttgcg atggattcaa gtacgcctac accggctttg tctgctcgcc aaaacaagcc       120
     gcgttggagt acccgaaact ggagcgtttc caccacgtct ctccggattt tgattctgtg       180
     gatgttgcca ttgcggcagg catgcaggtg gggagggcga ttgcagaacg ctggacgtcg       240
     cattcagcgc agcaccaaac atctgagcgg cccactcgcc cgccctccta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page