(data stored in ACNUC7421 zone)

EMBL: CP001069.PE590

CP001069.PE590       Location/Qualifiers
FT   CDS_pept        complement(672975..673619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4371"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0198 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29466"
FT                   /db_xref="GOA:B2UIR5"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR5"
FT                   /protein_id="ACD29466.1"
FT                   /translation="MTNLLALFATILLLNVMPAFAPPTWMVMSWVGFSRPDANPVLLAG
FT                   IAACAATLGRLVLARLSCTLVRNRWMREADRQNIDVVRAWLEDRKGMTVGLMLAYAFSP
FT                   FPSNYIFIAYGLTGMRLWLIGLPFFVGRWISYLTWTRIAQIGARYLDVETEIDGAYMGV
FT                   YFVVSQVVFLALVYGFAKLDWQHLLQTKHLRWRRRESIASSAKDTRTKVQR"
     atgacaaacc tgctcgcatt gttcgcgacc atcctgctgc tgaacgtgat gccggccttc        60
     gcaccgccca catggatggt gatgtcatgg gtgggcttct cacggcctga tgccaacccg       120
     gtgcttcttg cgggcattgc cgcttgcgca gcaaccctcg gccgcctggt tctggcgcgg       180
     ctatcctgca cgctcgtacg caaccgctgg atgcgcgagg cggatcgtca gaacatcgac       240
     gttgtacgtg cctggctgga agaccgcaaa ggtatgacgg tcgggctgat gctcgcgtat       300
     gccttcagcc cgttcccatc caactacatc ttcatagcct acggcttgac tgggatgcgg       360
     ctttggttga tcggcctgcc gttcttcgtt ggccgctgga taagctacct gacctggacg       420
     cgcattgccc agattggtgc ccgttatctg gatgtggaaa cggagatcga cggggcgtat       480
     atgggtgtgt acttcgtcgt gtcgcaggtc gtgtttctgg cgctcgtcta tgggtttgcc       540
     aaactggatt ggcagcactt gctgcaaacg aagcacctgc gatggcggcg acgggaatcg       600
     attgcatctt ccgccaaaga cacacggaca aaggtgcagc gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page