(data stored in SCRATCH zone)

EMBL: CP001069.PE593

CP001069.PE593       Location/Qualifiers
FT   CDS_pept        complement(676522..677778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29469"
FT                   /db_xref="GOA:B2UIR8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B2UIR8"
FT                   /protein_id="ACD29469.1"
FT                   /translation="MRLDLFRIVLAGAGTLVLWTAVAQAQGSSSHLPSENAVREAVALS
FT                   PDVLAAEARRDAVLARAEGVRAGTAETVVRAIGQRRQVRDPSERHAEGQITVERPLRLW
FT                   GKAQADAQLADAAAEAGQLAVKDARHEASRQVLTLWFGAVRAGQARLAALENAKAAADL
FT                   AALTARRVQMGDASRLDAELAAADRARTQAMLATAAAAEQTAQAELQARFPGLGHPAFG
FT                   ADTALPPLPQDPPDRLRTQYIQDSHEYRLAMAEEAQAQQMAKRADLERRADPTVGMFVT
FT                   VERGGAERIMGVSVAMPIGSAHRRSTAVAAAADAETAARRRLGAERRLGAEFDVLYGNL
FT                   QGKRASAQAQMEAATLQKSASDRAMRAYRAGESGLTELLAARRSLAEAQLAERLARVDL
FT                   LEADSRLQLDLHRMWDFDD"
     atgaggttgg atctgtttcg catcgtattg gcgggggcgg gcacgctggt gctttggacg        60
     gccgtagcgc aagcgcaagg ttcgtcgagc catctgccat ccgagaacgc cgtgcgcgag       120
     gccgtcgcgc tgtcgcccga tgtgctcgcg gcagaggccc gccgcgatgc cgtactggcc       180
     cgggctgaag gcgtccgcgc cggcacggcg gaaaccgtgg tgcgtgcgat tggccaacgc       240
     cgccaggtgc gcgacccttc cgagcgccat gccgaagggc agatcactgt ggagcggccc       300
     ttacggctat ggggcaaagc gcaagccgat gcgcagctcg ccgacgcggc cgccgaggcg       360
     ggccagcttg ccgtcaagga cgcacgccat gaggcatcgc gccaggttct gactctgtgg       420
     tttggtgccg tacgagcagg ccaggcacgc ctggccgcgc tggaaaatgc caaggcagct       480
     gccgatctgg cggcgctgac tgcccgcagg gttcaaatgg gcgatgcctc acgcctggat       540
     gccgaactgg ccgcagctga tcgcgcgcgc acgcaagcca tgctggcgac agccgcggca       600
     gcggaacaga ctgcgcaggc ggagttgcaa gcccggtttc cagggctggg ccatcccgcg       660
     ttcggcgccg ataccgcgct acccccgttg ccgcaagatc caccagatcg attacgtacg       720
     cagtacatcc aggacagtca cgaataccgg cttgccatgg cagaagaggc gcaggcgcag       780
     cagatggcca agcgcgccga tctggagcgt cgagccgacc cgaccgtcgg catgtttgtt       840
     acggtggagc gcggcggtgc cgaacgcatc atgggtgtga gcgttgccat gccgatcggt       900
     tctgcgcatc gtcgctcaac ggcggtggcg gccgctgccg atgcagaaac ggcggcacgg       960
     cgcaggctgg gtgccgagcg acggctcggt gccgaattcg atgtgctcta tggcaacttg      1020
     caaggcaagc gggcgagcgc gcaagcgcag atggaagcgg ctacgctgca aaaaagcgct      1080
     tccgaccggg caatgcgcgc gtatcgcgca ggggagtcgg gcctgactga gctattggcc      1140
     gcgcgccgta gtctggccga ggcccaactg gccgagaggc tcgcccgcgt cgacctgctg      1200
     gaggcagaca gccgtctcca gctcgatctg catcggatgt gggacttcga cgattga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page