(data stored in ACNUC7421 zone)

EMBL: CP001069.PE61

CP001069.PE61        Location/Qualifiers
FT   CDS_pept        72406..72690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3823"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3823"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28937"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH86"
FT                   /protein_id="ACD28937.1"
FT                   /translation="MDAYPICRYKGFDVYPLVYLFDPPREWHERRPDRSYNASVLICQA
FT                   GEQPSLEHSRIFRLSATPWENIGTAKRAAAKMAEDIIDGFAPGLSMAVV"
     atggatgcct atccgatttg ccgctacaag gggtttgatg tctatcccct cgtctacctg        60
     ttcgacccgc cccgtgagtg gcacgagcgg cgtccggacc gctcctacaa tgcctccgtg       120
     ttgatctgcc aggccggcga gcagccgagc ctggagcatt cccgcatctt ccgcttgagc       180
     gcgaccccgt gggagaacat cggtacggca aagcgtgccg ctgccaagat ggcggaagac       240
     atcatcgatg gatttgcgcc cggtctgtcc atggcggtcg tgtag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page