(data stored in ACNUC7421 zone)

EMBL: CP001069.PE65

CP001069.PE65        Location/Qualifiers
FT   CDS_pept        complement(74974..75456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3827"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reh:H16_A2179 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3827"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28941"
FT                   /db_xref="GOA:B2UH90"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH90"
FT                   /protein_id="ACD28941.1"
FT                   /translation="MKRFHVHVHVDDLSKSIAFYSKLFAAEPTRVESDYAKWMLDDPRI
FT                   NFAISTRGSTPGVDHLGFQVDDAAELAELKARAEAADMALLDEGETTCCYARSDKHWIT
FT                   DPQGIAWEHFHSLANIPVFSEGTQEAAPAEASACCAPRAPGGKPVGIAVKSGSSCC"
     atgaaacgat tccacgtgca tgtccacgtt gatgacctgt cgaagagcat cgcgttctat        60
     tcgaagctgt tcgcggccga gccgacccgt gtcgaaagcg actatgcgaa gtggatgctg       120
     gacgacccgc gcatcaactt cgccatctcc acacggggca gcacgcctgg cgtggatcat       180
     ctgggctttc aggtggatga cgcggctgaa ctggccgagc tgaaagcacg tgccgaggcc       240
     gccgacatgg cgctgctgga cgagggcgaa accacctgct gctacgcgcg cagcgacaag       300
     cattggatca ccgacccgca gggcatcgcc tgggagcact tccactcgct cgccaacatt       360
     ccggtattca gtgaaggcac gcaggaagcg gccccggccg aggcctcggc atgttgcgcc       420
     ccgcgcgcgc cggggggaaa gccggtcggc atcgcggtca agtcgggctc gtcctgctgc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page