(data stored in SCRATCH zone)

EMBL: CP001069.PE66

CP001069.PE66        Location/Qualifiers
FT   CDS_pept        complement(75468..75722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3828"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: rso:RSp1129
FT                   putative arsenical resistance operon repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3828"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28942"
FT                   /db_xref="GOA:B2UH91"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH91"
FT                   /protein_id="ACD28942.1"
FT                   /translation="MLVVAGPTGMTPGALAEQLDVPGATLSFHLKELMNARLVTQERDG
FT                   RNLIYRAAYDHMAALLGFLTANCCQGAACLEPSTTDCKC"
     atgctggtgg tagccgggcc aacgggcatg acgccaggcg cgcttgccga acagctcgac        60
     gtgccgggcg ccacgttgtc gttccacctc aaggaactga tgaacgcgcg cctcgtcacg       120
     caggagcgcg atggccgcaa cctgatctat cgcgcggcct acgaccacat ggcggccttg       180
     ctgggcttcc tgacggccaa ttgctgccag ggggcggcct gcctggaacc cagcaccacc       240
     gattgcaaat gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page