(data stored in ACNUC7421 zone)

EMBL: CP001069.PE67

CP001069.PE67        Location/Qualifiers
FT   CDS_pept        76071..76991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3829"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: rso:RSc0618
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3829"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28943"
FT                   /db_xref="GOA:B2UH92"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH92"
FT                   /protein_id="ACD28943.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQIEQWLAPHAFRPGNSLDMQSAGWA
FT                   SPRDDGALVYSTNRQMLLVFRAEKKLLPASVVNQVTRARAVELEEQQGFKVGRKQMREL
FT                   KEQVTDELLPRAFAIRRDTRVWIDPVNGWLVIDAAAQGVADDVRSLLVKSIDRLPITSV
FT                   QVARSPVAAMTDWLLSGEAPGGFTVDQDAELRSTGEGGATVRYVGHALEADDMRRHIEA
FT                   GKQCTRLAMTWDNRISFLLTPSLTIKRVTPLDVIKEAADATAQNDDERFESDVALMTGE
FT                   LGRMLTDLVESLGGDRHEAMHQAAA"
     atgtggttca agaatcttca gcttcatcgt ctgccggcac cctgggccgt gacgcccgac        60
     cagatcgaac aatggctggc gccccacgcg ttccggcccg gaaacagcct cgacatgcaa       120
     agcgccggat gggcatcgcc acgcgatgac ggcgcgctcg tctattcgac caaccggcag       180
     atgctgctcg tgttccgtgc cgagaagaaa ctgctcccgg cgtcggtcgt caatcaggtg       240
     accagggccc gcgcggttga actcgaagag cagcaaggct tcaaggtcgg gcgcaaacag       300
     atgcgcgaac tgaaggagca ggtgaccgat gaattgctcc cccgtgcgtt cgccatccgc       360
     cgcgataccc gtgtgtggat cgatccggtc aacggctggc tcgtcatcga tgcggctgcg       420
     cagggcgtgg ccgacgacgt tcgcagcctg ctggtgaagt cgatcgaccg gttgccgatc       480
     acgagcgtcc aggtggcgcg gtcaccggtt gccgcgatga cggactggct gctctccggt       540
     gaggcgccgg gcggattcac cgtcgaccag gacgctgaac tgcgctcgac cggcgaaggc       600
     ggcgccacgg tgcgatacgt cggccacgcg ctggaagcgg acgacatgcg ccggcatatc       660
     gaggccggca agcagtgcac gcgcctcgcg atgacatggg acaaccggat ctcgttcctg       720
     ctgacgccgt cgctgacgat caagcgcgtg acgccgctcg acgtcatcaa ggaagcggcg       780
     gacgccaccg cgcagaatga cgacgaacgc ttcgaatcgg acgtcgccct gatgacgggt       840
     gaactcgggc ggatgttgac cgatctggtc gagagcctgg gcggcgatcg gcatgaggcg       900
     atgcaccagg cggcggcctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page